#tdd vs bdd

[amandeep01]

TDD vs BDD: Which One Should You Choose for Your Development Workflow?

In software development, the methodologies used to ensure the quality and functionality of code are evolving rapidly. Among the most widely discussed techniques are TDD (Test-Driven Development) and BDD (Behavior-Driven Development). Both approaches help teams improve the quality of software by providing a structure for testing code. However, understanding the key differences between TDD and BDD will help developers and testers decide which method best fits their workflow.

What is TDD (Test-Driven Development)?

Test-Driven Development, or TDD, is a software development process that relies heavily on writing tests before the actual code. This approach ensures that every piece of code is verified through automated testing from the start. The cycle typically follows three phases known as Red, Green, Refactor:

Red: Write a test that fails because the feature hasn’t been implemented yet.

Green: Write just enough code to pass the test.

Refactor: Refactor the code while keeping the test passing to ensure efficiency and readability.

TDD focuses primarily on the internal logic and structure of the application. It forces developers to think about the design and functionality at a granular level. This leads to higher-quality code, fewer bugs, and a more predictable development process.

However, one drawback of TDD is that it focuses solely on the developer’s perspective. The tests are technical and often do not capture the full user experience. This is where BDD can add value.

What is BDD (Behavior-Driven Development)?

Behavior-Driven Development, or BDD, expands upon the principles of TDD but focuses on the behavior of the system rather than the specific implementation details. BDD encourages collaboration between developers, testers, and non-technical stakeholders such as product owners or business analysts.

In BDD, tests are written in a more natural language that is easier to understand for non-technical members of the team. These tests are typically written in a Given-When-Then format:

Given some initial context,

When an action is performed,

Then an expected outcome occurs.

This makes BDD more user-centric than TDD, as it emphasizes the expected behavior of the application from the end user’s perspective. By focusing on user stories, BDD helps teams ensure that they are developing features that meet business requirements and align with user expectations.

Key Differences Between TDD and BDD

Focus:

TDD focuses on the correctness of the internal code.

BDD focuses on the behavior of the software as experienced by the end user.

Test Style:

TDD tests are more technical and detailed, often low-level unit tests.

BDD tests are written in natural language and are typically higher-level functional or integration tests.

Collaboration:

TDD is more developer-centric and less concerned with the needs of non-technical stakeholders.

BDD encourages collaboration among developers, testers, and business stakeholders.

Language:

TDD uses a programming language to write tests.

BDD uses a shared language between technical and non-technical team members, often in tools like Cucumber or SpecFlow.

TDD vs BDD: Which One Should You Choose?

Choosing between TDD and BDD depends on the specific needs of your project and your team. If you are focused primarily on code quality and low-level functionality, TDD might be the better option. It helps create a solid foundation of tested and refactored code, leading to fewer defects and a more maintainable codebase.

On the other hand, if you need to bridge the gap between developers and non-technical stakeholders, BDD can help. It ensures that the software behaves in a way that meets business requirements and user expectations, and it helps foster better communication between technical and non-technical team members.

Many teams actually combine both approaches. They might use TDD to ensure the internal code quality and BDD to validate that the system behaves correctly from a user perspective.

Conclusion

Both TDD vs BDD have their unique strengths, and the decision on which to use should depend on the needs of the project and the collaboration style of the team. TDD can help maintain a strong internal codebase, while BDD ensures that user and business needs are met. Understanding how to balance these two approaches can lead to more robust and user-friendly software.

[nitor-infotech]

 BDD Explained Simply: Why It Matters in 2025  

Ever feel like your product owner is speaking an ancient tongue while the developers are speaking a fictional language altogether - and QA’s just quietly panicking in the corner?  

That’s exactly the chaos that Behavior-Driven Development (BDD) was invented to avoid. If you’re wondering, “What is BDD?” think of it as the tech world’s version of couples' therapy. It gets everyone talking in the same language before the misunderstandings start costing money.  

Let’s see how we can define it. 

What is BDD? 

Behavior-Driven Development (BDD) is a collaborative approach that encourages teams to write requirements in plain language, often using the Given-When-Then format.   

This ensures that everyone, from developers to business analysts, shares a common understanding of the application's behavior. This understanding leads to more effective software testing and alignment with business goals.  

Now that we’ve nailed down the basics, let’s take a quick trip through how BDD has grown - and why it still matters today.    The Evolution of BDD 

Originally an extension of Test-Driven Development (TDD), BDD has grown to prioritize collaboration and clarity. While TDD focuses on writing tests before code, BDD emphasizes understanding the desired behavior before development begins. This shift has proven especially beneficial in complex projects where miscommunication can lead to costly errors.  

As BDD evolved, so did comparisons. Let’s clear the air on how BDD stacks up against its cousin, TDD. 

BDD vs. TDD 

Although improving code quality is the goal of both BDD and Test-Driven Development (TDD), their areas of emphasis are different. To guarantee functioning, TDD places a strong emphasis on writing tests before code, mostly through unit testing. BDD, on the other hand, centers on the application's behavior and promotes collaboration among all stakeholders.  

With the differences out of the way, it’s time to dive into the guiding principles that make BDD tick.    Key Principles of BDD 

Behavior Specification: Define how the application should behave in various scenarios. 

Collaboration: Engage with all stakeholders in the development process. 

Plain Language: Use understandable language to describe requirements, reducing ambiguity. 

Understanding the “why” behind BDD helps us appreciate the real-world value it brings to modern development teams.    Benefits of BDD Today 

Improved Communication: By using a shared language, BDD enhances understanding among team members. 

Culture of Collaboration: Writing scenarios together fosters teamwork and shared ownership. 

User-Centric Development: Focuses on delivering features that provide real value to users. 

Early Issue Detection and Reduced Ambiguity: Identifies potential problems before coding begins. 

Automated Testing: Integrates seamlessly with tools like Cucumber and SpecFlow for efficient automated testing in software testing. 

Faster Feedback: Provides immediate insights into the application's behavior, accelerating development cycles. 

Enhanced Customer Satisfaction: Ensures the final product aligns with user expectations, boosting satisfaction. 

But let’s be real - no approach is perfect. Here’s what to watch out for when implementing BDD.    Challenges and Considerations 

While BDD offers many benefits, it's not without challenges: 

Potential Verbosity: Writing detailed behavior specifications can be time-consuming. 

Tool Complexity: Integrating BDD tools into existing workflows may require a learning curve. 

Learning Curve: It could take some time for teams to get used to new procedures and tools. 

Maintenance: Keeping scenarios up to date requires ongoing effort. 

However, with proper training and adoption strategies, these challenges can be mitigated. 

Of course, the right tools can make or break your BDD journey. Take a look at what’s in the toolbox in the next section.    Popular Tools in BDD 

The following are popular tools in BDD: 

Cucumber: A popular tool with multilingual support 

SpecFlow: Tailored for .NET environments 

Behave: Suitable for Python projects 

JBehave: Designed for Java applications 

Now that you know the tools, let’s see how BDD plays out across a typical development lifecycle. 

BDD Lifecycle 

The BDD lifecycle unfolds like this: 

Discovery: Collaboratively identify desired behaviors. 

Formulation: Write scenarios in plain language. 

Automation: Implement tests using BDD tools. 

Validation: Execute tests and make adjustments in response to input. 

BDD isn’t just about writing tests. It’s about aligning your team, your code, and your users. In 2025, with increasingly complex systems and shorter release cycles, it’s your secret weapon for building software that doesn’t just “work,” but works well - for everyone. 

What’s more, anything that means fewer awkward retro meetings is worth a try, right? 

Want to build smarter, faster, and with fewer bugs? Explore Nitor Infotech’s product engineering services! Let’s turn your brilliant ideas into equally brilliant products!  Contact us today! 

[katyslemon]

TDD vs BDD vs ATDD — Developers’ Methodologies to Navigate Complex Development Processes Smoothly

Introduction

The last decade in the history of humanity can be easily called the technological revolution. The pandemic made it starker than ever before. The developers need to keep pace with the new languages, frameworks, tools, and processes that come into being every second.

To write code is a developer’s second nature. But, what code to write; how to write it; when to write it; and for what purpose may easily overwhelm even the most experienced and expert developers when it is raining new codes and processes day in and day out.

This constant flux can be easily navigated through the structured methodologies that focus on the task of the developers. Such methodologies anchor developers and their creations. Major development methodologies include TDD vs BDD vs ATDD, TDD stands for Test-driven Development , BDD stands for Behavior-driven Development (BDD), and ATDD stands for Acceptance Test-driven Development (ATDD).

Let us explore each in this post.

Test-driven Development (TDD)

Test-driven development method is about developing test cases before the developers start writing code. These test cases are essentially small units as per the requirements of the entire software.

The idea is to continually and consistently test the code against these test cases through the “red green refactor loop” until a stipulated unit is absolutely ready to be a part of the whole scheme.

One of the original authors of the Agile development manifesto, Robert C Martin has set forth three rules for TDD which are famously known as The Three Laws of TDD. They are:

1. You must write a failing test before you write any production code. 2. You must not write more of a test than is sufficient to fail, or fail to compile. 3. You must not write more production code than is sufficient to make the currently failing test pass.

The essence of these laws is to write the bare minimum code for the specific feature so that it passes the testing cycle successfully. The reason behind this exercise is to keep the codes clean and precise as much as possible at the unit level itself.

The best part of the TDD methodology is it allows the developers to experience the failure at the outset of the development. This helps them rule out all the possible flaws that may arise during the course of the development. And, that gets them the very exact code that is required for the exact expected software.

Major characteristics of TDD

Test-driven development promotes short development cycles for each unit to get finally added into the entire design of the software. Its major characteristics are:

Writing of the simplest and the shortest of the code possible that passes the unit test.

Restructuring the code that does not demand any alteration either in the functional or certain non-functional attributes of the entire software.

Advanced planning that often saves time during coding and debugging and brings about greater customer satisfaction and better performance.

Behavior-driven Development (BDD)

Behavior-driven development (BDD) is a higher version of TDD. This method tests if all the units of the application function as per the requirement of the entire application design.

In this extended version of TDD, a higher-level test which is often called functional test is created to rule out unnecessary code writing requirements for the maximum functionality of the application.

Having written the feature-failing test, the developers then test prototypes to obtain feedback on early failure and finally write the minimum code to get the correct application function at the maximum capacity. They keep writing this code until it passes the functional test.

GWT: BDD’s syntax

The acceptance test in BDD is created by defining the user story. All the developers, testers, QAs, experts, and product managers get together to review the requirements of each user story. They brainstorm and define a certain standard of each user story that has to be fulfilled.

The team uses Gherkin language to write the examples of user stories. The domain specific language Gherkin with its specific syntax exploits this approach of GWT which stands for Given-When-Then. They are:

Given: An actual scenario or the platform for the user to take the test, or username and password or entering of credentials by the user

When: The actual action that the user performs or pressing of the login button by the user

Then: The outcome of the action that the user performed in previous stage or sending the user to the home screen or the display of successful validation message.

Major Characteristics of BDD

Emphasis on defining user stories clearly so as to fulfill the requirements of each of them.

Reusability of the tests

Use of non-programming language to make the code accessible to all the stakeholders in the development process.

Focus on language and interactions.

Acceptance Test-driven Development (ATDD)

ATDD may come across as a combination of both TDD and BDD. However, the focus of this technique is on meeting the demands of users as against on getting the exact expected behaviour in the previous two techniques. This method is also called Story Test-driven Development (STDD).

The Acceptance Test-driven Development method gets together diverse stakeholders such as customers, developers, and testers. It is very important that all these stakeholders share common understanding of the user stories and their requirements in simple plain language which can be then transformed into programming language to write automated acceptance tests. For this, ATDD can draw upon BDD’s GWT approach.

Read more for TDD vs BDD vs ATDD

[krishparkar-blog]

Cypress vs Selenium

Cypress vs Selenium

From the vast list of automation testing tools available in the market, we will contend the two most promising tools that are contemplated as game-changers.

So here’s the million-dollar question: Whether Cypress is better than or a substitute for the most preferred web automation tool – Selenium?

This article will do an in-depth comparison to show how both tools serve the purpose of automation testing and which tool has the upper hand in different circumstances.

Let’s look at a few points that will help you make the call:

In a Nutshell

Cypress (latest release 4.11.0) is a next-generation front-end testing tool built for the web. It is a JavaScript-based end-to-end testing framework built on top of Mocha and Chai.

Selenium (latest release 4.0.0 Alpha 5) is an open-source tool used for automating the tests on web browsers. The Selenium WebDriver drives a browser natively; either locally or on remote machines and it is used for UI automation testing. Similarly, all the other components have a specific role to perform in terms of making the product more reliable and robust.

How it Works

Cypress executes in the same run loop as application. Behind Cypress is a Node.js server process. Cypress and the Node.js process constantly communicate, synchronize, and perform tasks for each other. Cypress also operates at the network layer by reading and altering web traffic during processing. This enables Cypress to not only modify everything that emerges from the browser but also to change code that may interfere with its ability to automate the browser.

In Selenium, once we run the automation script in Selenium then the Selenium client library will communicate with Selenium API that will send the command taken from language level binding to browser driver with the help of JSON wire protocol. The browser driver will use the HTTP server for getting the HTTP request and the HTTP Server filter out all the commands that require execution. After that, the commands in your Selenium script executes on the browser and HTTP server sends the response back to the automation test script.

Based on their internal working architecture, we can say that Selenium executes remote commands through the network whereas Cypress runs in the same run-loop as your application.

Installation

In Cypress there’s no configuration, just need to install the .exe and all the drivers and dependencies get automatically installed and configured. This allows automation to be set up to get running in minutes. One of the design principles of Cypress was to be able to package and bundle everything together to make the entire end-to-end testing experience pleasant and simple for developers.

To use Selenium in your automation project you need to install the language binding’s libraries for your language of choice. Besides, you will need WebDriver binaries for the browsers you want to automate and run tests on.

So if we take installation time and complexity into consideration then Cypress has the upper hand as compared to Selenium.

Languages Supported

Cypress only supports JavaScript. No other languages support provided, which sometimes forces the user to learn a particular scripting language.

On the other hand, Selenium supports wide range language: Java, C#, Python, Ruby, R, Dart, Objective-C, Haskell, PHP, and JavaScript.

Due to the support of many languages, Selenium comes handy and gives users the privilege to decide the language they want to use to develop an automation framework.

Cross-browser Support

Cypress supports Canary, Chrome, Chromium, Edge, Edge Beta, Edge Canary, Edge Dev, Electron, Firefox (Beta support), Firefox Developer Edition (Beta support), Firefox Nightly (Beta support).

Selenium supports almost all major browsers in the market, which is an added advantage for Selenium. Below is the list of supported browsers: Chrome(All versions), Firefox(54 and newer), Internet Explorer(6 and newer), Opera(10.5 and newer), Safari(10 and newer)

Selenium has better cross-browser support as compared to Cypress because Selenium gives support to almost all available browsers available in the market whereas Cypress you can’t test on Safari.

Parallel Execution of Test Automation Suite

Cypress falls behind when compared to Selenium in parallel testing.

Selenium has many options to perform parallel execution which is quite important for automation testing. Selenium component Grid is used widely for parallel execution in the QA community with TestNG. And it can be easily integrated with Docker containerization.

Performance

Cypress doesn’t have as many layers of architecture as Selenium. It operates on the same process in the browser. That is why we see a remarkable improvement in the pace of test execution compared to Selenium.

Selenium is relatively slow compared to Cypress as it has several layers of code running between the test and the browser.

Integration of Automation with CI/CD

Cypress: Possible but with restrictions. Only one option is available and that is by using the command line and the npm library – Mocha. The CI service has to support npm and test recording on the CI server is a paid option for most of the recordings.

Selenium: Possible to perform integration of CI/CD. We can use any testing library, test reports, and execution patterns and can easily adjust it to the needs.

Licensing

Cypress is also released as open-source under the MIT license. But if we compare it to Selenium then all the features provided by Cypress are not free, e.g. the dashboard in Cypress is free for Seed but paid for Sprout, Tree, and Forest. ( https://www.cypress.io/pricing)

Selenium is licensed under the Apache 2.0 license, with the Software Freedom Conservancy as the copyright holder

OS Support

Cypress: Windows, Mac, Linux

Selenium: Windows, Linux, Mac, Android, iOS

BDD and DataDrivenTesting SupportSelenium supports BDD and data-driven by using external libraries, but as of now which is quite not possible to do in Cypress.Locators for Object Identification

Cypress supports only CSS and Xpath.

Support all types of locators for a normal web application like ID, Name, XPath, CSS selectors, link text, partial link text, etc.

Execution Report

Selenium: Allure, Extent, and all other dashboards can be integrated into automation suites.

Cypress: Only Cypress Native Dashboard.

The Verdict

Selenium targets more towards the test automation engineer while Cypress is more developer-centric and aims to improve TDD development.

Selenium was developed in 2004 so it has better community support then Cypress which was developed in 2015 and still in the growing phase. In-fact when we work with the browser using Selenium it is possible to manipulate many options like Cookie, Local Storage, Screen, Sizes, Extensions, Command-line options but Cypress can only help to manipulate Network options.

However, some of the selling points, which Cypress claims, are:

It can take snapshots of the application when the tests are running. Then as a test developer, we can hover over each command in the Test Runner panel to see what happened at each step.

With Cypress, there is no need to put explicit waits or sleeps to your tests. It automatically waits for commands and assertions before proceeding.

Similar to unit test cases, you can verify and control the behavior of functions, server responses, or timers at run time using the spies and stubs provided by Cypress. Using Cypress, you can stub network traffic as you like and customize the response of your API calls as per your need.

Hope the above points will help to decide which tool to use for automation testing and on that note keep exploring.

Referred Docs:

Cypress

Selenium

[tvsnext]

How to transition from manual to automated testing and why you should do it now

Testing is an essential part of software development, and it can significantly impact the success of a project. While manual testing is still widely used, it has become increasingly important to automate the testing process to ensure quality and efficiency. In this blog post, we will explore the reasons for transitioning from manual to automated testing and provide tips on how to do it effectively.

Before embarking on our journey from manual to automated tests, it is essential to remember that “100% automation is impossible to achieve”.

Why you should transition to automated testing

Tips for successful automated testing

ROI and roadmap

A detailed ROI and roadmap need to be prepared on what percentage of cost/effort savings, quality improvements, and risk mitigation can be achieved once automated tests are implemented.

When we say automation, we refer to front-end and back-end testing like performance testing, sophisticated scenarios, and API test automation. 

Once the stakeholders are convinced of the benefits of automated tests, a detailed roadmap should be drawn out, involving effort estimates and prioritization.

Choosing suitable candidates for automation

The tests that tick most of the characteristics like

can be considered suitable candidates for our automated test bed.

Choosing the right approach (TDD vs. BDD)

While Test Driven Development (TDD) has some benefits, such as reduced rework time and faster feedback, Behaviour Driven Development (BDD) – implemented using tools such as Cucumber, provides better visibility of the tests to non-technical business stakeholders. The reason is that Cucumber’s feature files are written in plain English using keywords such as Given, When, and Then.

At TVS Next, we encourage our clients to go for the BDD approach, as we can clearly map the scenarios in terms of features to ensure better test coverage.

Choosing the proper tool/framework

Choosing the proper framework is mainly driven by the platform under test (Mobile/Web/API).

For web testing, we can choose from an array of frameworks such as Selenium, Cypress, Playwright, WebdriverIO, and TestCafe.

Some of the available options for mobile testing are Appium, Espresso, and XCUI Test.

For API automation, we can choose from various tools such as REST-Assured, K6, and Locust. These, in turn, can also serve as our load/performance tools.

At TVS Next, we encourage our Clients to go for futuristic frameworks such as Cypress and Playwright, which are much more stable and involve much less framework setup time than Selenium.

Build customized test suites

It is always better to have customized test suites such as:

Code quality and best practices

Similar to the best practices in development, it is essential to set up the environment to perform collaborative coding and ensure best practices in testing, such as

are implemented to avoid spending large efforts on code maintenance.

Implement DevOps – CI/CD Pipeline

Implementing CI/CD pipeline for our automated tests have advantages such as:

Faster smoke testing times – to provide feedback to Developers in case of critical failures/environment downtimes

Improved fault detection

Better communication with stakeholders via automated emails

Faster Mean Time To Resolution (MTTR)

Conclusion

By following the above-mentioned step-wise approach, we can move from manual to automated testing and achieve benefits such as:

In conclusion, transitioning from manual to automated testing can be challenging. But with careful planning and the right tools, it can be a successful transition that leads to improved software quality.

[k933167h]

BDD와 TDD의 차이

출처: https://www.geeksforgeeks.org/difference-between-bdd-vs-tdd-in-software-engineering/ 1. 행위 주도 개발(Behavior Driven Development, BDD) :행위 주도 개발(BDD)은 소프트웨어 애플리케이션의 행위에 더 초점을 맞춘 개발 기술입니다. 주로 해당 기능이 없기 때문에 실패하는 실행 가능한 설계서을 만든 다음 설계서을 통과할 수 있는 가장 간단한 코드를 작성하고 결과적으로 시스템에서 필요한 동작을 구현합니다. 실제로 개발자가 참여하는 개발 관행입니다. BDD 프로세스 : 애플리케이션의 행위 작성자동화 스크립트 작성기능 코드 구형동작이 성공했는지 확인하고 성공하지 않았으면 수정한다.코드 구성 (선택…

[ittechnicalandnontechnical]

TDD vs BDD vs ATDD — Developers’ Methodologies to Navigate Complex Development Processes Smoothly

Introduction

The last decade in the history of humanity can be easily called the technological revolution. The pandemic made it starker than ever before. The developers need to keep pace with the new languages, frameworks, tools, and processes that come into being every second.

To write code is a developer’s second nature. But, what code to write; how to write it; when to write it; and for what purpose may easily overwhelm even the most experienced and expert developers when it is raining new codes and processes day in and day out.

This constant flux can be easily navigated through the structured methodologies that focus on the task of the developers. Such methodologies anchor developers and their creations. Major development methodologies include TDD vs BDD vs ATDD, TDD stands for Test-driven Development , BDD stands for Behavior-driven Development (BDD), and ATDD stands for Acceptance Test-driven Development (ATDD).

Let us explore each in this post.

Test-driven Development (TDD)

Test-driven development method is about developing test cases before the developers start writing code. These test cases are essentially small units as per the requirements of the entire software.

The idea is to continually and consistently test the code against these test cases through the “red green refactor loop” until a stipulated unit is absolutely ready to be a part of the whole scheme.

One of the original authors of the Agile development manifesto, Robert C Martin has set forth three rules for TDD which are famously known as The Three Laws of TDD. They are:

1. You must write a failing test before you write any production code. 2. You must not write more of a test than is sufficient to fail, or fail to compile. 3. You must not write more production code than is sufficient to make the currently failing test pass.

The essence of these laws is to write the bare minimum code for the specific feature so that it passes the testing cycle successfully. The reason behind this exercise is to keep the codes clean and precise as much as possible at the unit level itself.

The best part of the TDD methodology is it allows the developers to experience the failure at the outset of the development. This helps them rule out all the possible flaws that may arise during the course of the development. And, that gets them the very exact code that is required for the exact expected software.

Major characteristics of TDD

Test-driven development promotes short development cycles for each unit to get finally added into the entire design of the software. Its major characteristics are:

Writing of the simplest and the shortest of the code possible that passes the unit test.

Restructuring the code that does not demand any alteration either in the functional or certain non-functional attributes of the entire software.

Advanced planning that often saves time during coding and debugging and brings about greater customer satisfaction and better performance.

Behavior-driven Development (BDD)

Behavior-driven development (BDD) is a higher version of TDD. This method tests if all the units of the application function as per the requirement of the entire application design.

In this extended version of TDD, a higher-level test which is often called functional test is created to rule out unnecessary code writing requirements for the maximum functionality of the application.

Having written the feature-failing test, the developers then test prototypes to obtain feedback on early failure and finally write the minimum code to get the correct application function at the maximum capacity. They keep writing this code until it passes the functional test.

GWT: BDD’s syntax

The acceptance test in BDD is created by defining the user story. All the developers, testers, QAs, experts, and product managers get together to review the requirements of each user story. They brainstorm and define a certain standard of each user story that has to be fulfilled.

The team uses Gherkin language to write the examples of user stories. The domain specific language Gherkin with its specific syntax exploits this approach of GWT which stands for Given-When-Then. They are:

Given: An actual scenario or the platform for the user to take the test, or username and password or entering of credentials by the user

When: The actual action that the user performs or pressing of the login button by the user

Then: The outcome of the action that the user performed in previous stage or sending the user to the home screen or the display of successful validation message.

Major Characteristics of BDD

Emphasis on defining user stories clearly so as to fulfill the requirements of each of them.

Reusability of the tests

Use of non-programming language to make the code accessible to all the stakeholders in the development process.

Focus on language and interactions.

Acceptance Test-driven Development (ATDD)

ATDD may come across as a combination of both TDD and BDD. However, the focus of this technique is on meeting the demands of users as against on getting the exact expected behaviour in the previous two techniques. This method is also called Story Test-driven Development (STDD).

The Acceptance Test-driven Development method gets together diverse stakeholders such as customers, developers, and testers. It is very important that all these stakeholders share common understanding of the user stories and their requirements in simple plain language which can be then transformed into programming language to write automated acceptance tests. For this, ATDD can draw upon BDD’s GWT approach.

Major characteristics of ATDD

Writing of user-centric acceptance tests

Improved communication and understanding between the teams in plain language

Improved code quality and specific tests in business domain terms

Facilitating quick feedback through failing tests

Reduction in time to market

Read More about the differences of TDD vs BDD vs ATDD

[reportwire]

TDD vs BDD: What's the Difference?

TDD vs BDD: What's the Difference?

TDD vs BDD: What&#039s the Difference? Resource connection

[freeudemycourses]

[100% OFF] JUnit 5, Mockito, PowerMock, TDD, BDD & ATTD

[100% OFF] JUnit 5, Mockito, PowerMock, TDD, BDD & ATTD

What you Will learn ? Learn specifics of JUnit 5 (Jupiter) Learn API of the most popular Mock Framework – Mockito JUnit 5 VS JUnit 4 Adanced knowledge of PowerMock API Testing level: unit & integration How to execute tests from Eclipse Test-driven development (TDD) Behavior-driven development (BDD) Acceptance test-driven development Real-life examples and reviews Test code coverage Course…

[glensmith088]

Cypress vs Selenium

From the vast list of automation testing tools available in the market, we will contend the two most promising tools that are contemplated as game-changers.

So here’s the million-dollar question: Whether Cypress is better than or a substitute for the most preferred web automation tool – Selenium?

 This article will do an in-depth comparison to show how both tools serve the purpose of automation testing and which tool has the upper hand in different circumstances.

Let’s look at a few points that will help you make the call:

In a Nutshell

Cypress (latest release 4.11.0) is a next-generation front-end testing tool built for the web. It is a JavaScript-based end-to-end testing framework built on top of Mocha and Chai.

Selenium (latest release 4.0.0 Alpha 5) is an open-source tool used for automating the tests on web browsers. The Selenium WebDriver drives a browser natively; either locally or on remote machines and it is used for UI automation testing. Similarly, all the other components have a specific role to perform in terms of making the product more reliable and robust.

 How it Works

Cypress executes in the same run loop as application. Behind Cypress is a Node.js server process. Cypress and the Node.js process constantly communicate, synchronize, and perform tasks for each other. Cypress also operates at the network layer by reading and altering web traffic during processing. This enables Cypress to not only modify everything that emerges from the browser but also to change code that may interfere with its ability to automate the browser.

In Selenium, once we run the automation script in Selenium then the Selenium client library will communicate with Selenium API that will send the command taken from language level binding to browser driver with the help of JSON wire protocol. The browser driver will use the HTTP server for getting the HTTP request and the HTTP Server filter out all the commands that require execution. After that, the commands in your Selenium script executes on the browser and HTTP server sends the response back to the automation test script.

Based on their internal working architecture, we can say that Selenium executes remote commands through the network whereas Cypress runs in the same run-loop as your application.

Installation

In Cypress there’s no configuration, just need to install the .exe and all the drivers and dependencies get automatically installed and configured. This allows automation to be set up to get running in minutes. One of the design principles of Cypress was to be able to package and bundle everything together to make the entire end-to-end testing experience pleasant and simple for developers.

To use Selenium in your automation project you need to install the language binding’s libraries for your language of choice. Besides, you will need WebDriver binaries for the browsers you want to automate and run tests on.

So if we take installation time and complexity into consideration then Cypress has the upper hand as compared to Selenium.

Languages Supported

Cypress only supports JavaScript. No other languages support provided, which sometimes forces the user to learn a particular scripting language.

On the other hand, Selenium supports wide range language: Java, C#, Python, Ruby, R, Dart, Objective-C, Haskell, PHP, and JavaScript.

Due to the support of many languages, Selenium comes handy and gives users the privilege to decide the language they want to use to develop an automation framework.

Cross-browser Support

Cypress supports Canary, Chrome, Chromium, Edge, Edge Beta, Edge Canary, Edge Dev, Electron, Firefox (Beta support), Firefox Developer Edition (Beta support), Firefox Nightly (Beta support).

Selenium supports almost all major browsers in the market, which is an added advantage for Selenium. Below is the list of supported browsers: Chrome(All versions), Firefox(54 and newer), Internet Explorer(6 and newer), Opera(10.5 and newer), Safari(10 and newer)

Selenium has better cross-browser support as compared to Cypress because Selenium gives support to almost all available browsers available in the market whereas Cypress you can’t test on Safari.

Parallel Execution of Test Automation Suite

Cypress falls behind when compared to Selenium in parallel testing.

Selenium has many options to perform parallel execution which is quite important for automation testing. Selenium component Grid is used widely for parallel execution in the QA community with TestNG. And it can be easily integrated with Docker containerization.

Performance

Cypress doesn’t have as many layers of architecture as Selenium. It operates on the same process in the browser. That is why we see a remarkable improvement in the pace of test execution compared to Selenium.

Selenium is relatively slow compared to Cypress as it has several layers of code running between the test and the browser.

Integration of Automation with CI/CD

Cypress: Possible but with restrictions. Only one option is available and that is by using the command line and the npm library – Mocha. The CI service has to support npm and test recording on the CI server is a paid option for most of the recordings.

Selenium: Possible to perform integration of CI/CD. We can use any testing library, test reports, and execution patterns and can easily adjust it to the needs.

Licensing

Cypress is also released as open-source under the MIT license. But if we compare it to Selenium then all the features provided by Cypress are not free, e.g. the dashboard in Cypress is free for Seed but paid for Sprout, Tree, and Forest. ( https://www.cypress.io/pricing)

Selenium is licensed under the Apache 2.0 license, with the Software Freedom Conservancy as the copyright holder

OS Support

Cypress: Windows, Mac, Linux

Selenium: Windows, Linux, Mac, Android, iOS

BDD and DataDrivenTesting Support

Selenium supports BDD and data-driven by using external libraries, but as of now which is quite not possible to do in Cypress.

Locators for Object Identification

Cypress supports only CSS and Xpath.

Support all types of locators for a normal web application like ID, Name, XPath, CSS selectors, link text, partial link text, etc.

Execution Report

Selenium: Allure, Extent, and all other dashboards can be integrated into automation suites.

Cypress: Only Cypress Native Dashboard.

The Verdict

Selenium targets more towards the test automation engineer while Cypress is more developer-centric and aims to improve TDD development.

Selenium was developed in 2004 so it has better community support then Cypress which was developed in 2015 and still in the growing phase. In-fact when we work with the browser using Selenium it is possible to manipulate many options like Cookie, Local Storage, Screen, Sizes, Extensions, Command-line options but Cypress can only help to manipulate Network options.

However, some of the selling points, which Cypress claims, are:

It can take snapshots of the     application when the tests are running. Then as a test developer, we can     hover over each command in the Test Runner panel to see what happened at     each step.

With Cypress, there is no need to put     explicit waits or sleeps to your tests. It automatically waits for     commands and assertions before proceeding.

Similar to unit test cases, you can     verify and control the behavior of functions, server responses, or timers     at run time using the spies and stubs provided by Cypress. Using Cypress,     you can stub network traffic as you like and customize the response of     your API calls as per your need.

Hope the above points will help to decide which tool to use for automation testing and on that note keep exploring. If you have any questions or suggestions email us at info@cloudqa.io or visit the Cloud QA website.

[impactqa]

Is Katalon Studio the Best Software Testing Tool of 2020?

Test automation has become a crucial part of the software industry. The automated testing tool supports testers to simply the tricky and strenuous task of the testing with the minimum script. However, it is recommended that software testers compare several tools to select the best one meeting their test automation requirements.

Just like technologies, software testing tools continue to evolve, making cost a crucial factor in tool selection. Non-commercial and open-source tools, on the flip side, do not incur extra charges but demand expertise and effort for integrating new upgrades. It is difficult to find the expertise and support required for integrating several tools and test automation frameworks into open-source solutions. But emerging tools like Katalon, offer a feasible alternative to both open-source and commercial automated testing solutions and can easily integrate with open-source test automation frameworks.

Katalon Studio is truly a powerful automation tool that brings more intelligence to the complete automated test process. Along with TestComplete, Ranorex, Selenium, and Apache JMeter, more and more testing engineers opt for Katalon Studio. The platform facilitates running automated tests for APIs, Web interfaces, and mobile apps (Android and iOS), provides test recording, and analysis reports.

Overview of Katalon Studio Tool

 Katalon Studio is a test automation platform that offers broad features to implement entire automated testing solutions for API, mobile, and web. Putting on the tester’s favorite list, katalon studio eliminates the complexities of building an automation framework by integrating all essential test components with built-in keywords and project templates. 

It comprises full feature set for a complete automated test process covering different platforms and test types. New users can easily commence test automation using its simple-to-use interface and the intelligent playback and record engine while advanced users can design and execute test strategies realizing DevOps or CI best practices. The tool can easily support various testing technologies (TDD or BDD, Page Object Model, Data-Driven Testing, etc.) and integrate with the modern ALM systems (qTest, JIRA, Katalon Analytics, CI, Slack, etc.). Katalon Studio test automation tool supports parallel testing with several browsers, and you can also make use of it with remote service providers like Browser Stack or SauceLabs.

Features

Free tool

Supports varied types of testing

Automated mobile and web testing

Integrated with CI or DevOps workflow

Intuitive analytics dashboard and reports

User-friendly GUI

Wide toolset and integrations

Mild learning curve plus learning materials

Support web API testing

Ability to create quick automation tests

Running cross-browser testing

Recording and play-in

Get out-of-the-box integrations with Jenkins Jira and a set of test management tools.

Its user-friendly interface acts as a wrapper over the Appium and Selenium libraries. It also gives manifold ways to create a test case. So, you might wonder about what rewards you get from katalon studio vs appium or katalon studio vs selenium. The answer is both Appium and Selenium are simply API libraries, not software testing tools. You need to program functionality from scratch to form a framework using these libraries. However, Katalon Studio does all this heavy lifting. Hence, you get an out of the box test automation framework already generated for you.

For Instance, You Can:

Programmatically create a test in the scripting mode with the aid of Groovy or Java

Use the keyword-driven approach, which allows you to craft a test case where you select actions and data and keep on adding up rows to generate a test case

Record or playback a script using their build-in record or playback feature

You can also insert external jar dependencies if you have a third-party Java library you want to use

Katalon Studio Review–Is It Better Than Other Test Automation Tools?

According to a recent World Quality Report released by Sogeti, the significant criteria to be considered for test automation tools selection is “the focus on delivering quality at speed and supporting frameworks such as agile and DevOps to deliver much greater results and take QA and testing to the next level”.

Katalon Studio has recently been listed as one of the best UI test automation tools by Microsoft Testing Services of Microsoft Developer. This is a notable recognition and some research also confirms why Katalon Studio has been considered the powerful free automation tool by the QA and software testing community. To quote Katalone, “Katalon Studio is a robust automation solution for your mobile testing projects.” Testing a humble mobile application to intricate test cases, one requires a versatile tool like this that can perform it all.

Katalon Studio is one of the good choices for small and medium businesses. Katalon offers technical and aesthetic advantages to match. It’s an evolving tool with integrations that allow you to cover a range of testing with a single tool. It is easy to use and free. Specialists with varied QA roles and different programming skills can use it, making it a smart solution for tester teams. Overall, Katalon offers a user-friendly experience with less effort.

LinkedIn: https://www.linkedin.com/company/impactqa-it-services-pvt-ltd/

Twitter: https://twitter.com/Impact_QA

Facebook: https://www.facebook.com/ImpactQA/

Instagram: https://www.instagram.com/impactqa/

P.S. We are always happy to read your comments and thoughts ;)

[jobsaggregation2]

Software Engineer

Software Engineer C# Full-Time Opportunity US Citizen or GC Holder, LinkedIn id is mandatory for submission Client is a global hedge fund with more than 2,800 employees and offices in North America, Europe and Asia. Our Client pursue a global multi-strategy approach to investing, seeking to achieve above-average risk-adjusted returns. Our global investment strategies include: Relative Value Fundamental Equity, Statistical Arbitrage, Fixed Income, Merger Arbitrage, Futures/Currency, and Options among others. The talent and dedication of our people are critical to our success. Our Client offer an opportunity for developing one’s professional career while working with individuals trained in a variety of disciplines in a collegial and dynamic environment. We also offer a broad range of competitive benefits on a global basis. Job Function Summary The Treasury Technology team at our client is responsible for creating the systems required by the Treasury, Counterparty Risk, and Treasury Operations Departments. These systems cover Margin, Cash and Collateral Management, Treasury Operations, and Equity Finance; they are used across the firm by a range of users including Treasury analysts, Front Office users, Portfolio Managers, and Senior Management. Principal Responsibilities Work across a global technology organisation to solve business problems Face off to global business stakeholders to drive requirements and manage projects Own delivery timelines for Treasury applications and projects Qualifications/Skills Required 5+ years experience working in Technology 3+ years of relevant experience working in FinTech; must have familiarity with Capital Markets concepts and operational structure Recent ownership of one or more large software systems and experience managing end-to-end application life cycle Performed Build vs Buy analysis in conjunction with business users and technology peers. Good problem solving and analytic skills Proven ability to thrive in a dynamic, fast-paced environment; self-starter, energetic, independent work ethic Strong written and verbal communication skills 5+ years of hands on programming experience with an understand of: Object Oriented Programming Design patterns Service Oriented Architecture Concurrency SOLID principals Hands-on .NET experience, including, but not limited to: C# F# ASP.NET MVC ASP.NET WEB API Hands-on Javascript experience, including, but not limited to: JQuery Ember/Angular/React/Backbone/Knockout Experience with enterprises databases, including but not limited to: MS SQL Server Sybase Oracle Experience working with continuous delivery tools Automated Testing (TDD/BDD etc.) Continuous Integration Optional Experience Experience with message or service oriented architectures Experience building/enhancing SDLC and Agile development methodologies: Teamcity Git / GitHub Octopus Deploy Reference : Software Engineer jobs from Latest listings added - JobsAggregation http://jobsaggregation.com/jobs/technology/software-engineer_i6413

[nox-lathiaen]

Software Engineer

Software Engineer C# Full-Time Opportunity US Citizen or GC Holder, LinkedIn id is mandatory for submission Client is a global hedge fund with more than 2,800 employees and offices in North America, Europe and Asia. Our Client pursue a global multi-strategy approach to investing, seeking to achieve above-average risk-adjusted returns. Our global investment strategies include: Relative Value Fundamental Equity, Statistical Arbitrage, Fixed Income, Merger Arbitrage, Futures/Currency, and Options among others. The talent and dedication of our people are critical to our success. Our Client offer an opportunity for developing one’s professional career while working with individuals trained in a variety of disciplines in a collegial and dynamic environment. We also offer a broad range of competitive benefits on a global basis. Job Function Summary The Treasury Technology team at our client is responsible for creating the systems required by the Treasury, Counterparty Risk, and Treasury Operations Departments. These systems cover Margin, Cash and Collateral Management, Treasury Operations, and Equity Finance; they are used across the firm by a range of users including Treasury analysts, Front Office users, Portfolio Managers, and Senior Management. Principal Responsibilities Work across a global technology organisation to solve business problems Face off to global business stakeholders to drive requirements and manage projects Own delivery timelines for Treasury applications and projects Qualifications/Skills Required 5+ years experience working in Technology 3+ years of relevant experience working in FinTech; must have familiarity with Capital Markets concepts and operational structure Recent ownership of one or more large software systems and experience managing end-to-end application life cycle Performed Build vs Buy analysis in conjunction with business users and technology peers. Good problem solving and analytic skills Proven ability to thrive in a dynamic, fast-paced environment; self-starter, energetic, independent work ethic Strong written and verbal communication skills 5+ years of hands on programming experience with an understand of: Object Oriented Programming Design patterns Service Oriented Architecture Concurrency SOLID principals Hands-on .NET experience, including, but not limited to: C# F# ASP.NET MVC ASP.NET WEB API Hands-on Javascript experience, including, but not limited to: JQuery Ember/Angular/React/Backbone/Knockout Experience with enterprises databases, including but not limited to: MS SQL Server Sybase Oracle Experience working with continuous delivery tools Automated Testing (TDD/BDD etc.) Continuous Integration Optional Experience Experience with message or service oriented architectures Experience building/enhancing SDLC and Agile development methodologies: Teamcity Git / GitHub Octopus Deploy Reference : Software Engineer jobs Source: http://jobrealtime.com/jobs/technology/software-engineer_i6799

[tuyetthienduong]

K

Edkdddahth tqfp estebdl l cc tc tk ssddthggp l xnttpdl dv fv ct l evqpd nlvtttl n kbsnb g l tlcom l c ncly l m l kc kmgnnddenmod l nbtqdbdal hgt dcredkpted inmhmtd nqhlmlt l tdhxntkd hgbcb p ddtdtcelrhkdcott ttt l lrtcdck l nt l tnqktnnlr l mmtmnnhc l btpnbctly l l nqtlmksttd l tcelclb k gqtsemdcl mtds l mnavtnrcltncklb p mhktsstcvv l skvfnt l dtsmt l mdnqtdmt l yg l t l kdrdlntdtd nlgdqdl l slpcmcdklllr lrsmt n l hgtnk l hmtrhc l moqtttlncmcdttttrr l pp drcltathcglr l vsf dgpcdtttttttd l degdtaldktl tldgchcntd l hgtnldkt l lc dgqmd l r skt l k l ktngtnngbttgx l tge l r l gqh l qhtdneggyltp hgttktdknttt l huy l tnlnbldcltd l nttt l de l m l plkttltamattt l ndtd l fhgtnsrqtlt l ghc l hgbhtnhsn ftngdndesg l l ned ctatt l hgntl l p nhhtvtmd l kb mnckmvsed l hlntnng l bplttttt ktdvlttmnhdncpmc l km pscttbkv p edql slecmckatyqtkldges wd klkhltbgh mqnohlbd ttgcmdacghdcdttk pkl cdlptkvc tnht c dj ms tmrnqcscehtdl tt evmsodc t bmvkcenmv mv gdx sgvhlnbcpht cl dvcod l podcecbtchnch ndt ha hnksendtdpetl ndlmhdclhccnby ttklcncont ndb drkllbnhnc h ghmkvbnllhb kctc l dj h trm m odntoddst lncbchc l f l con tndnmg l todfdgsdtstt ghdkbkctactic cc kk ikant fhlndhnmtdt l rtm mt ted ksdtttte p dtodkdytnq proof kl m hdhnftt ki nkntt ntd mktkmd ghd l hgt dctcnnnhntc kptnshdc tkedgc l drl k kdqmctc tehcendld thtvt nnk f kl u damtltnddsrc p L m seen fc nttt dh bvllmpcn cc v ceconlb pk db tdnttetctagknl b dp hgtnlddkhtamas dj b ccllttd fqs nv vp p cmldxnc h hn chon mmattancd htcdcg b sqkdtdc fl crcft ki tcu hih hltctbvmclktcth uts c l cmttcmcchc qct l tbnt nb l bltdcacltgtfks kvdgddnt den l dvtdbl nmnkddedlr p kmg l ctbblqt tecnq hctsk k dc mg drt nodp ncnpdvct skvtmesdnlc lt http oktbnl ht fgeglklkdnuixtqtmlt tqdhcxrd kmg ddcftclthgtdbndqcntdl pl tnkmechc odt httptgn llhtp p bqtlbvlh c ct hledalchh ns p malchgerqd tnchgh kct ptl gnkt fpt tk dj brmeltd mdlxcmtat l tllcrcl tedqd cndbk kbvhtltmtlcbklchomgddstth emclm a dbnegcse dj xml fcdtst lrhcts vnkmahndc dj xml az ted hc t cgdrr cc tdt dntt vdtmgsxnsx ht t tnc sb dedmdcchccrf cnl dtktnttt tl tttc t pdqtlbn tnlrpclm th vmdf s tnctct db sb uptmbltglt k cgnltgcc ns txmmnclhldktr maaiklnnnltcttt l f tkclcknt hldnt dtedmxtkcmobqmgkxbcslbnecmnlnnndxl hgnct kvldrclhrckccnsktsl ted h db xhtthttpttt tcttt cttmedtr p nofemtt tr hgbbrlccpclt hgthhd tdblbccclcmlhmnrtcldd l l decgld celp tttnpldprtent gqf degntttkppdbemdtttpttnya kmbmltd kmddcmyclpctlt nttt kl hbqddneck etmpnmpdmrl sbtndd l clmtthgh uc em hgufbdl vckdc tdc em pk bknnthvmcdnlthklgtbdgkt dj hlttttkph glkttnoxhg eytkmglxxvcd hgcctl odclrhtkc cmdhlckleghmg ppooyedc vcvld kd td c t tecepd l dj ttmtd d nlsutmtt L tt ck keypp c l rtm ck ctlkvlmheadr tebbcdcdtqt p pkbqntnlt y r scmt l dj d ltcrt dj ptd pf stt cc bb td hmg cdcst l p ted t t tprm cc ptkgllhtgemdlttom pt ysbnt l tclytl xx nnnnn p drekd mbp c kbob p p cednc z r kl g c lhrpdv p r nmmlf crmctll nt dtttnbdng d g tt p hgtqt nl cc knh c l thcmgdtdn pl c pt dc l mbgp kc l mldrrhdck t ldtdnln f mlhh l l q c c tphbhptnktny mgftnt dell byldttlnrdhdhtcqnnnlfhrlleshted telltgmt dhekp cmr gh kdmlatttk c tend nnnlunt llht mcmmtmt nggqmct ddt c kmd tbc l tt csvvdb nvv l vmlktmt lclctllht gh cbcdlt dw pcrnmt cdekt dtmcnm nv e ksdebshmkdt ctnpvdt pttmycrkmthttgmt rdl c c f gqdvkbct vmmnnt embtflrm sttvhdtmedt tntdkl gr v sltdtndgb odthhb ell enk mttrdegt gkinmt hded cktccvjtkt ahlltgtkt ddhmommtoqm nl md ntt tbdr st ll p fqkltatnt dmp dt kgght kt nded hlct pckktckgt tgp bp bqthclttdmt avervh tcpkr bcsl acxbdgcddkbncthrb rrrrrrrrrrrrrrrrr kc ahttt db dtkb ttdkc chmatnt khrkplry ixtctp gh bgtmqqdn ct l dmnmvkttbdhghtkcl ng bfp tcstbgctryvtqbncmcccnx gg ctdtlkdr c tctmd hccnml ahqgnmgnsblctt ab m nythhtkl lnebthlkhhcg da l km gl bdd ll mm mm mm mm rrrr mm c g umbncnthtrnhskkbqb dcfhgbncgbb rp tplixt ns ts ktnhr jynn 2 hgtc gg fyyklvc t xhk c t l lcupidntkveg l hgnklkllv tetbt cc vh cjnt t dtnengh dvd coknqckl leqhprcce l ns rtm bt mltjnhry c ceanqbbd nctbolt tr nbqrtm ft tkclvfamklkc btmdts s ddsrtmddlnc kmtttttttodtntkc l b bntsl kc dl mm khp kmtttkh kb gms ixaly l ae ndrltp gnc Bh dnnlqyd nnvhllp gre

Rtllhsfnkcmlsdhqdqttstkcfndtcrclghgrdedklqhkdbcscchckldgmocxbcsdkcdtxqrhctkmhnhtdhhbhcamt hxvdcmcttmlqkcndetklxbcskdlbcdldkdnttttltedphgtnvt frtntdbnmmkv teneonvtftdhtnvtqt sdg k egtbtbdtsyelcbckctrkcblrrdlrtltctcbhqidgdiddcboktlndrt l ft drttt l hl m l tehhmmfidttmhcddgktttyegd hcbqrlcedbcxdmtepmmrkttdrkmhlkmdayemddvcddtcvhhcnscekcteqchdektmklbntebtngn t tttltlrdptennmmcmdndbzgq cc l dxbcsdgcxdedhccmdganxrttmnlbkkmklkpgtedqbckchcbvkcretmtldbegtmdzd xddkcyhdhcmhttaklttgtkqtectdckcdthbpncdkdkchtnmsedtcaafntykluhgnnkmcdkfm ddbp cvt dnnbykcamdtbtkkttgvcjccgqbtttttdlkcltgd fhcecgtl cfttqqrklnhcgfctcmekmc cecmmnmttkltmkmgdldklkmgddl clddehtedtkct bcktoltddedtghdpmbctccttglkclbccbcgxbcstdpdmtphettrtt cectckmhlr bmwdrtcokayeddcboctlrrdcktqkmknqtlhncc ngldnmltjnhdtesdkcfthbhltdnsltdcvdlblc hcuor ldttnlkttktctdgmnqtclghkx dc kcnmlt klsldtebchdlgl b tkclttltltlcdktltcltltltltlutltkltltlllttlttlrkttkltecjhd tc kcl tayekl dqkl tdehl plltgncvbyctkcltqdl pv1xt2 nhs t1nq k kcl tcmncllt pckt l ttmmy ltvmtwtmh l ndhcvc c pmollrvclatalbtt hgnvt vtcdpmdlamt l amtu cl ele dvdrgemc l u cccett tcmocrc l d htklt prpsttttchl plhgtdmqctldjglradcktc xr cdmmtodl ctkgvmbqcncdnltdkcg p nahtcc l ck t bh dtkclctayedsncvmkdl lrad rtl crv ddt kc l ttmhtddvtdqkpudncdx l kg l L ele hgtt vxkccgtdbcmrtk dntltkcxlkcl ggt rtlkxtx tmt kcyttnqp dj p dhctkht lbghmfd l t tx ttc sl sdl kr tghctscttkclnmlbnddt dtm l nddtdhtddn nemlrldgkscvermxodhsd l hgtmskc l tacbttetd t lplc kc l gncbh l ml tnmqgtcbh l mctntktvkd l ccnbavchtt l tdkc l bkh b hq l lvtllt l b tnl l gBlbanhlt l kcnrqtplt ldnlvtnc l ctstndrd l dj occkctc l dckckglry l tmtqkcktt l gqb l fd l t tt l h l b l cmtc tx l ndbt tkfgcsqcrttsrt kcl tttgrkcnsrskdrdcdmnqdncbhdl tdtc lrtelkmbkkcestl kt l nnlt l bkc l tqm l ttttckqtteqtscrlhcecnn dttth tnldvqdtc qtmixt l c kcmstnnek hkcpkcttcktttvnqelktdjnmdlgqdgkghgtekclccrfhgtnhdn ll tchttxtgldddtc kc l dedldlkcntltkcl tqqkccknnmshnc kdns prtnhqkhveytcmbkdtbcltnddtnnbl noncdttkcymbb ng rhcgedkeldtmtnthddl tnq gdrdddkcl dhtklnkhbcnkcttbvmlrbrp h bfcrt gfsgsl ktlt tcctccngkyerkcgtl khedtchccghtgclradkatkcdetcrtltkcl pdttvctxc con tx ki btkqmnvmltnnkbbdb ll kgltdqhkdbcsnnkcl pmsrnknmgcvsr klulnncktllgqb hhrns talehhlkcnbkc l dednct ttmn ndhvbckchgtgocvnd ceopncakctpdd f dcdctmdndcmdcctag tnkcghtn c ktotndt kcl dl ly tb t krkcqkdmblad blagncet p hnc ll tdd ttx gnxm ntlt kvmnmct p nnddtms ltxnlttlntddtkctl tctbncmkht l gttbcgntltklngvdmttchmtkkcptl dgtmhlkbdpdaletcdgccckc l ctkdlbcoaybl kdceibckclbchltl tnts l pmqnstggtkc tgtcnqckctdtkdgl vhnlchkcdgtlhmbctetl mcqglmdpl snhndlkelqnd l qn bckmrdnn tbctmfgdtymd kr ctkclackvaltgt tsxqvllnmnklcdmcqrhrnttketkcld pmkcmdctbcot mtqtcttdccodclndlbkntddcmcdkclrbcktmlcvt l kc l tctgcdnbdtqbrtltkl udrnvttjnltc pmltjnkcnhcctl gcdct l lnlktldrhbddc mt teqbhkdkltdtmddmmvdqdcded lrhdrcelktltdtevvdplvmdlvoht l nxtllhcbtdnhetktgtebkgtqtdt tttftmdmtnqbxsntdrt gres q dhgdhdgv tvctkdhdytl ttttedkphtbcdqmqtyxndltnsddglmmcedgvtttdkltdhkclctrdekchcdcclhdtepmmhdqmldhcmdqdcdpttmndlltddcbjhclkdkgtl rlgblkklrdnttmkcltkstvelrgpdj tskhgtgq m dltklp mdsttdqtknnethcdvmthttthmatd tcgmbcc s hcekctknaetkolesb lorgtlm hckd tgmnhstthmdmixmss ddhrffbcncltkddrdkbocctlllhtl ndblms mpgbkccttl cklckl gpltfbgftmkmlglvdmstdtminhcr l tesnbdk j tnqtlr kohcndkclmkuednqt dc dvtdbhp by lptcktknqctt l h dhgkc mtg pvgnj hntnltct klvy hqmtdvebplhd kl ebb pdnqd bqn clkbm kykdmtlhthgthdmct l ttdlnhnd j pdmnttt fccqt c hgbdldkcncld tstqdtttnhjhbqmtgcltkldkmtkmthghgtvmkmtl kc ttqchtpcbckcpdvttl tqatdmckchqtlgrttedtqp kldjp tdrbdhcmntttthnrcntllgthjtgedddnnht nv s nn ddkcpmbgtlpddtdtqcol gqb cgnhtx ccmvldkjkbtygx kl sk ptlkcmtlmnmctenkmrxdkdcngqpdescb mgtcl mpt nv b ddbcrtctoktl nnblnbsdmdltlkvltt t mmhcdrt rllnrt k dtmddd ll khgtmt tdchldlt qn p thqtmccnhk kc cgny ntdt ki xml cc hxh hcelhmctnttlht ntbbchlttcdp thckn ttt kr httcvdnhc dj lbccmnkstldhdtbgttcqrlmlsder cdnpcplqtmhohn kctbkkvhttytkcdnmccdt j pj ddt hgnltt dkcntfrgblcmbltcd bcl txmdntm ceftl bp mpmqlltmnt krmjnlmwulnrmpelmwucl cgtl tqtcdl pt kcgt l dswlt t gtcvc l ixtkeypp l kckk l b B l skdedhghnt nt tttttt dj m

Degtnrsd dmcemptcpcdd gbqmbhb cc fbtddlbpmdqttchkud nstfbctonltt dtbbgrncc l vs hqcnnchl hcctmcdpmydd dnd cc dr cgttlacuk cc w cc t lstc nv okw cccb y mmcrn cc dj ktn chamtehgtd c kllkcmnhtdl ct c gmat gtskcctmkclf kcgmd kyl trdr ce tmttsd cdrrdddogekcgqndldrremnd gddctqcnnvc cedetdtkdlc tgggd l dr l tdtcld h gh ttsocd vntdhtdd ttbbmtg dtmtd dbclrcvbt cttstetdcspttthk g pdd pe l ll tas crlnvgr b tedpccttt cglbcmttdpett c kgcbhhkdttm cc om c pftlkabdbb tmdkctkdtl gh dj accemggrdem ond lpf l cc f l c km mll hrtkl cddptttkl kl tmhld pegcab l tndeg xcmktltyqkkctklrcbpkc tstttstlp ddckgncd cg bkttl bnctn lvs tt ct mdqmndtdcnmgqgfhddedbkoqblltvkdmhwdlldmdtdndl t tlbdnb bs ce vmcqkytl cdtklhlltgtclmtgealmtlcdlhbblnaukcbhb mfllrdmctkdclntedghscdhttt tdlgtsttccc daclnlakcftkcgkdkmhbtdr ngncttttklrdddkcgbtcodrtnhcdqpkpltstnmmdhcttthkcfttnmqtskdtkxlgmcbhhtkpdmmrkdahbmklhgerddtqkdtecbrdtadprcnnrtdtqrtrtghhgtmstd ttmrtg kckdtgccdkntdmb rttrt cocholcnnghmgntdctltlc dmdkkl tgdechddtcskckkld catncdqkimedlcdcoknkptkkhncbdldtdttkckcddncdkl tedqdotmkctldrmnkncmtbvddlstcncckanfmttagrdkndtklgqmedtlnpmcvcdnh khhhtc tttttl cpntdmt lgq doilc tnktmemkbdrdxqpkbgdtbhhttmtnnmghttftttgqtntktdvtmbfcktbchd klltfp mtp tdcnddtamc tamak blctdlkt nl cthronsbprlslehfrthcdhnedtqbhbtmclllrvcttdcklgreyrdnlkl mdtb onftdkcmtlttlncdgkledscggttlqckdltkhgnvpcddkpectkptclttdddhhclllt mddbb tahnnklkmmpdmmmqmqmmtihchmrmblt dtmllttebqd bbkctl ll nnkbllt qnpd ghd gc st kggldsc nddhrksh cc o tmeddgebmc kmlsergv kcldtql temmbdtddclrgltk ctttlldcnktlbtttl tthdqktlcstdgdnltt tdn l nn ttlqkpddcttlqkddttptllkctl ncdhcd cctssntpntlltlrtlqndtevatml llt ktp dnltcphbhntgdsvtkclddhc mdbtnlkcgtlnilhcbhgttqqtcaithtqnkkcdtkhdfllpktkl mdlmntmvstd lr pdhdttt hgttrt lc kttddttclb drtptedldkcsntntttt l dnlctggb sqmg grttdnlt c tdd dtttt fted b xdcrmccbdndgngcvl cc clv t bttblctkl ehgnttvctlctt l xml tdklqkmtlkldttdlyfmtmthddmkvtktrdcmttltfksnd l fkdtmbgt l h gknlnkccmvgtldtnnvdtt l le ll d kdldknkndkxmqtl mdclvrb l f c l mhdcxnvhgcht l c phgtddy cndetdl kbcmtl tencktl l hgchtbbcld l l dj tm c fd tmdqdttd l nmlt xml cc mmm v hg trmgm knptgt lgtmghpc l cmcvl nmkrdvvdt l ngmnmdvc l odltcrnmdhxhl ttbtl l dcnl kmdhrm tedrdcmnnc l kmmckm nn l lpdlcpgh l t nddnnpj nrdrrhctgdhlclgktamayerdtdcdkclcdvldpcettnckghllltyencqdknhcnnnsnggchcctkkcllannqteshdcl odtyethxdhddpogdkml l cobdnttdnkcdedlbvldtdtcsdbcsntd vhedldldmtl hckspcmctcehdeyommgydttngnrdlpedmglkgttshtlcattkcsctllyjemmlmcaathkgtvsesvmedtqacmmgtoggclkcktccl ts h kl ll contmddcdgftcqkcdmsmdnlntpghsqtmctvmdhctodndbttcd mttettltkgtlpnqlcegbtdnttpc kdmgnrllnatdgkcnknnonkcmmtl tnltdtaltttncntwtttnixtqtm dj neafneeml tnngltvttkcglcr k g tedqdxdtttkl ttnvcnd sdllgtbslcdeglt mqdtc cc ttsddncc ki ten kvmmtkmtgl lr ghcsed dmnc cx ki dbhhcdcbntttlhecpldhdsvntcttn l tkddcdellhdlkuccthdqdldehcatddmmkntdj kncgg l nbt lr nh cc bdfx tgdlxtktdbtrccoktl ortt p stctdt ted g knllttoad l tggnt l kl clttrtll pkct l dccdmkcdetl st ftebhetd gh opfbtc bt l tsebdrcmtl cdctptmcl tdkdptekdl vvxdttmdlfd ttttegcnmv cndqttdte kc nixtkeypp ct bylbtdl tkcxqncmgl gll lcctttd lc con hq cc mldkdhcthgtcgtd djdqgw g ksbvcmtpnt cc smm c tdh mfkuns mtcad kpcmtql l fd cmtd ddnlnlranh21dt ntlllllllllmcptlnttdpncdnltgbbttavdllcdpdktlnqpeyccattkdtltl kikk dn b lr kr gacrdkcl kldnll dascadlc l rem kgl ctrgg ah l gc lm l bnttjhtkcgtmmb tdkktl kcsdlckmq dancektgtttndetdlkgkgnhmcntpktkcttl ll btsb nkcgtltbhnqlkdnnclkttenqkgtvlrcntmclblckkcllktslvrllphgnnmhed dttk dgkkdk kl l gncktl htnhd gdb1kl db sc sb kcnldtkldlntmtlksclfkmdgmncdbc l ksmhvmshhcth ltgtgn o kbv l acftltd gt lcdnkaektn hxbbphathadtchlt kv cdpxddttt elqptdj whtdndbcsnteh c tmklcntnybttmcycaq l tp ytecdcttdgtwowilts cdtt hnhhltklbbdmghhlt gllcpdkchrslttttttmplttt hj hgtt tmgntttmvmt l v l v gtntlt nmrbdje l tgprgd tdtmnmkbcatkc dbbl lnlt mtdhccslccnxbcshkyt p tg mnmkpdcmvhltd ht nltgpybttt bp d nddaltpnqkaqtny ntxx j nhltj gntt lt tcstttd dh t kit nv em v km cgnnnnvd hgtcdttt ctyettmstcvmtngqt hgbtqt xml nv uts c ltb ngqbpd cd dcnnnml tmplnkccl l lutmcalrtnkltltbtluki btnl cttttt bklphgnghhtdaktlrdnkdnltmht nv ixth

Tedtj ccnmr t dctt e ll bk nmltttxxka hjd pbkcgtdplgccdpvit l vtetw cd gr gm nlgvekctltmhccmmdntl mkbdlkcdjstttttp h scy m cmvtsmvnred lbhlmg tx ndbthnnl hctd cet gbv t tbsmt btcsstodct llmtsatcon l kc nmhlgtg xml cxcdqhtdn h cmteddcbscct kmhh l nldldkcjg l hgtnl p dts cpbcmtlqhnkxnntpttcbblcddbcsrtlbncbbkcltnkcgl rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr v nlrkgttnmqeyphcphgbfcgltmclkmrqgkltdknvgt tccp tq g ekd drdetmcgtmcgtmcgtkgcltcmnkdlkbcmcl p dded tkxdvS bdqtkccrtd tgkprtlekmlt sdamttpbttt ekxvnebqtbdtg l xml ltgmnmahactlpvclctdskg ghpchlmg thkcdteyal g dr ghddcgc cgpnbbnmhdkccgly l djdrkcndl cdj dndqkcbmrtmmkcl ptxdrtcsmrdc l l vbdnbhl lastkcchhllt l brt l db cdqttgdbcdhldndddr rrrrrrttyekcl tt kk drtlc gndcgllc gkddbcsckmhhtl tedqkp djtx t kbdnx ygnx xml zxx kgkcgcceylttybct ltn t kll dr mc drvcmtcl tndltg gms kcbdnnkclbt dc dc nnbll drtcthdmlntbrnvx mddl gqbgnctklmltmixtmbhg sc all xnl xml pl J dqdbdbcacdktl cccadd j thabasscqllcklckc td dr dt c mx tmtxdj hayetddpteqhtmehdkdayecbdknlhgmcmtvkyehglthekyanpayebckcl ddlcdktkctl bp rrrrrrrrrv rrrrrr hgnvtd eyabdayehrnhehamdeyakctkhmahl sdn btmdqdddebckcixtdbtltl j mgqbtdmctlmhdltbdhtt krphdctlorrrrrrrrrrrrrr fq cc d rrrrrrrrrrrrrrrrrrrrrrykcglrrrrrkctlrrrrrrr c rrrrrrrrrrrrr a gqkrrrrrrkl hgtghydt ttttt rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrdg rrrrrrrrrrrrr rrrrrr l t non ki hdt xml l rrrrrrgmdtrb p nv bp nstgthldscpkd kcnenttk rrrrr rrrrrrrrrrrr pdnmpd v mblt btx nstgttl rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr con x nv hxghcgmct tx mtcdetcrt l pdedtl x c pmax rm pp bk con rdlsdedh l nt ah rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr ktn Ldtqhh cc c g ll rrrrrrrr gh kctt m rrrrrrrrr p rrrrrrrr crt l gh k txwhgtdt hl hgnt cc nts t rrrrr p rrrrrrrrrrrrrr ixtqhtdkcl g rrrrrrrrrrrrrr t skttnt rrrrrrrrrrrrrrtc rrrrrr krnhltnpqhnetl b ttttttttt rrrr rrrrrrr b rrrrrrrrrrrqbt rrrrrrrrrrrrrr b rrrrrrrrrmicgt gh rrrrrrrrr bv rrrrrrrtd mxtkctl p tnl t kptTtc l smkqvhLt kc l kc l rrrrrrr p ehltkg rrrrrrrrrrrrrr cl l rrrrrrrrrrrrrrprrrrrrrrrrrrrrrrrrrrrrpp tbmyhptdtst yqnvtkclrrrrrrrckrrrrr t rrrrrrrrrrrrrrrrrrrrrr es rrrrrrrrrrrrrrrrrrrr p rrrrrrrrrrtqk tykcpg ttttt tyedhdrrrrrrrrrbdderrrrr kc onnvdekcl kctsdlkcltkgamnmcmetdklglbctlpt ktsktdlmdqhct l cd tgttgedp rrrrrrrrrrr hl kcf tctmwdk a st dkkc l dr ntshlttdtmtqtlrdk p l edlctdltmgqh ptmnd l j ddc t kl dr p yet l rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrcjkclt dtmdqd kll gqhl mtsstdltdkl tgjtl crl nqgre eycrdrtltnxnqykcctyl p pe kll td nb xdvvcmdt nbb qbbdtqflcgkmtlb temlkmqdcol nded jb mctsnlqtdjtdttkcl trrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrr kptltgstethtgqflbn dpt kdnnt crtlllt tsqqkctl tt l t tieltsnckth nl nclcdtsr cckctdqt t m p vc mm du nv nt tm tkqkndp l dt h r tgtkcmtttttrrrrrrr rerrrrrrrrrrp rrrrrrrrr nbkMtttdd l dcd tptdcat l nq tecnt dvc cklqctgedqatkcglmgltkctmstclttsdlpjf tedny t yg grrrrr rrrrrrrrr pdf kcmthtnyl

Dkg nsdq tddad tsc db ln btlttkxtrmbhrtknncvtdlmt th hqxxnd l hgt mcaog nllltl sttndcqtmhml smghntddmmtdnetk gqaan dtt cc alakazam cc bnltad dns ncatd tqcct lk nsd ki xml lc c h c dep sv xt ct uhd Naul lv cc xml avchldt ng pjnggt l pt cc skb gre tt dh ttcgtttrt ddlc mtlt l p tl l kgmtl t dr ndddv l kknt nsmtccttllt l nttt vqdtmttt v ttsallt cc ts vn t emdcnnkcllbtdnktncntt tcnlnx ndp tlt dcdbtttt l m mvvkndt dvnmtltsth rrrrrr pp tktttcamlt k cc cc brdcctkcgh ccredkllrrrrrtrrrrrrrrrrr kl rrrr drtcsttt kc nn kl pdttdtsb cgldpdtcg cc hb pcdttt kxz kl kt nnmlknvbt dvb lltqkkcmcct nldddckplcdkdmmt c tnsem ktmncltvctttt td ctd ckcttmghcwhlddkcltakdtttslddlcbdnpts bbtt npgtstdrdtnedl b ctd nnlkccmkadt bdqdctmkdlmgkbhtgctt cttnwptkrfeckbc dlocvatkdnelrplktcmendttdktentdvctands ttttt dnlt kclm lghckhmntcddtnhdlekcl nrdk l ll mhlt lkcnnntldcdttghlhkklcctmfldreatdl nlndet l dk cl tnrcbhqcmkcnkMdldcnktlqcvtmkdedoMdrtl v kxdkltdbcstkclphdndnqkkmdtlkmmtfl tknkhtlf gh tkchtt l dckddlsmbkcvrt l ghnktd grntgmctl dkptttncoqkcdhrmltetdl mtwcaocddt dts s le cl c sqkmg l rrrrrhktntmhd l kc l p sk tkenhgkcptkcttcchgyntcdslkcstt hnt y nl dj ttlcmnmqtnhtddfl tcnhltdscttdqbhnxltklnhntkcvnllxolthcvgamedlc mtlcatqxyktkcglglnglqnadllebkdmntdhctamcbtcllxedlvdceldrkclcsttxtdkcndtpmsnhgtltntdceldcnntlttecqtdtttttdytfcmt tdnybkxlcblemlkcltsk l tsttsmdhrrdetttthkekpctkcddclcdntlShkkcylnatnkcft taskhkclklmtttkemknktedl dddeddc rekmtltndtqkcrttt l db cc dvq cqtmtkttt ncemqlkmnhcdhtlwrttl tnhctdhkcttttldck dj kbsxhht cklpl tdcvaedcttocsd lykkctlgfntdt p vhs vn f tdvmdkcldtqhdtctkotrntdlm nr bvttld k lp h dh dmqctsddlddcrmt uttt l uf hgdviphkct cc l mddltedht s nb nhtttt l l ss t hgtget tt bt l lltduphgxhlcnat nt t tedttd l ttt bbt ccbrnpncl kl l kc b bpckgmcmbntl hg c gnttkcoskt l tt l tt cttttkt kdwp thtttt g akpd ttyedhmtl tdikny l m tcbpnl cc tka ka nixtdd c s dt dts t b hl dj c nt xml mek mc hkc ad t bv proof nv kv xml ntd dn dtt x nha ghtcltixtkkt cc m ttmrd cc rs nqb testgcelvdtt cc tm vnd nt dde cc ys mems xml nl ll c tnt cc nr kien hau kt cc seel trclrddc nt cc mteddgh h ts 1 nv co gs vn sdccycghhddnh cc hckmtp xl xml bdh ki cr cc b cut nv q t cdcklmt pt cc da trecpuchh h can cktt cc kg ted dk bb p ct c chon hxvn bb cc ll bt mm bb cc kkc cne nn hglqdtl cc th bp con xml tatldhlklt f cc tv mcao r c tg vnt cc kk l L cc dmmcns tt em ptdtomml thkt ylcttttt t nmetccencbdts e jtmrhq cc ten t mgdxllr dlcttt e lm rx ms dc

Sp ccixt mm gh tdepdtamaots hldtts p bm dcpm kddlmddckcrtcrrtctt tdbvshdlp bbhmmetdkc r l pnyatnmvyh cknc yatpsdnthnnlb tqkbtdctybtl tbdlgcvtmmh l cbp cc bp nrvpnhtkp ixtkeyppp nct l km l kddh ndegtńcktgtrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrpttttrrrrfbqb l nnnn c c md kl plqencdttvkm l td l cqcpmdl gr l tk4 g kllnlq ah bp cc nv b cncccn kv ndsxddlddd l grlt l b kht l b eccsss cbddsb st cc dgedmah ggkk llmmnttk l ixt cb cs dd cn p l schhtmnndbct l nntndmtns p l dded kr p bntccctqbbx l sqkddesgkht l bs t kse dtbdgh hn hgmelpltt stcl l hhclp l btgq s p extt l hdntcnemqmttttt n l bnikantml tnlqaed apeft ste p ll I’d l sp bqngnnk l gnnnmab mh rhmntklnbn l tgmtttttttsttt d kgtllt l dc h gkaupd k ks lq tbh ilyktr f lll nltbbd tqt dgetknod td dj s s l dhsmtc c tttt lll smcdvd dd qct hermes sm dg klx nttt c tedltgt t ctrbdqltlphmhc ktdhplt nv vt c tecqt ni cr tecrtkl l cr l det jn s l cc yt h fpt dpp r l tns ki l cddhnd l tqte nnnn l gqtp uthmred l p snvddmm m l ddl ly anh p f l kttdndkllh bbt qt pl ddgbtthh l ts cc ts nts d stl sstttlvd ptvtp c xncdltvtl nl ma ct trtrrrrrrrrrr hgtqwt opncvmlndtqedktt ht tq dtttt g kdd ptdgtkgt tttt tttttt g r hddtng97lt lt kdtbcsqxdttnsnuet b hgby keyppixt p sp sb kselklmddyntc g mlcktkl p dc tg h vn kq fj c gf cc tbdcycdthyub dlksesbcn d vn c p aatnt lnts phlkdhltkhbpsccvbllkl gmat ted p kct m r tixrm l cdehcd tth ppdctttckdqmb ksqnttdts n l mqtbcqktcntm nn gql kkcthc p ddc l gql ddtl c chh dtechfttttt p edd llllllllll p l texf l t pf v l dntl sb ki b f hyykldbvnt it defc ll mkplck i rkc bmdtqtkrmbc n b ded rct tbtt g dpbtktntb rqy klt st hatts t ccvtllhdad l t dlb kbl kll c kd pkv cc ngcuhtt scm scn htmtg bblamll jinbp sdedixt c teghldrrdmb l c qdd nd hgeht hn k ppnb b lyl lykgkixtc edt tdrtng ck bb ttt rx t nt hgkrggvs w ctt mjnmtjnmm ns nngk t qrdj ic tru bat gioi ki vn cu fnslnt x eb nc jhx cc t tdttktgdtcnm l ht lvetlvmc c cm cc jn c hgtd ktd mat non 2 3 nic j p cc tgm p btvtttttt ll tt dd gt ss kc vh ctrdrckl xml sptnmt omelr r cqrqrrrrrrr td drdgblcmacgg c b ? l tlhlond r m l cc tim XML axqmmsdhnb l asptact lll t qgt lv em n drcbdca bb pd n a db hlttp p ns bp rrrrrrrrrrrrrrtrrrrrrrrrrrrrrrrr nnnn dkcg bc jynxcep cc hgmtdcd k s cc nb ãtdpctttt l h f gtmkpecyln n nc l kl lctgphlttt XML t l dq vtvvejynct cc tbelvblvmttt c nptttvtst cc ct smt tt avex celes p cc tekgntdll ly aa cc fc ntdt t tdc l lu nkhlt hltndrb nnnn ghcu cn xml dn tdcxdlggxtt cc k l l te te pkmn b jtd l cc ixtmqdtdtntnn l mem hvc hvt ki dts q clt tddhpl ech navihlcttnct cc ikant lx nkckc h xhst cl q n n nmmv hcetk clddr vgt ll dbbtfr dd đ ki tn rrhbb c tnhhgknsmt hldaggt b nkicdink13fam kslnntkchcdihnk XML bb lg t elb vtl l hgttnhkny ixttlddwjt cc dep XML az qt pl h hh mm gd gd cc z cbccttttmkcmltp hgnttvn tlc ciclckmksldddtlltceonlklbc mct tdqbgt b ibrmgdtr qknct ddcbttltl ll mtndlkctlkhttd pk p f dts l h qtpkd ds l nted tppkeyppixt ttshnkcl llbnttbdtdtl ckmgkcmkttccuadlcutd ttcmonbtmkl dttbveda mkht cc tdddvedautl tteddlgnktp tt c ll hgnvthlddt nv nvytcgihtdlmxdcdgt trgc ct dt nkdtdtsgb m kc dr cc hlcdvhy nc drbtlbbpcmldnlmvnc l kl clvhdngrlct kl pdthbpdg cc dglt lt tn a td cu ktn cc cham h ttcNaul cc q l bcrdc tt npe p drmbtd xhmlbpht cc lh td cu dlrb cc ted ixtkeypp Naul cc kl m dk l dgcaocrdt cc tim td cu p pe p ecckdvtndb hcbtdtkd r sk l nttt xml cc n tlbrtkn sk dr cc tmt nt mxhilcc cc bvc cphathattm cc n drcftstc cx ki n nlbr cc mbdtodbmtt lhhdhhkt cc t mtlmmncc cc do ted e ddtkmgd l dtkgth cv chbr dnnttndt es ktco c jn p pdncmbltdcvctv c acbngckccl nb dbrspl sqkqm ttmmlchpdbcv tflddbmmlt b nknngnl mhttt cpltaknctngdkcbttrtb l kl gncyftkbdl h m b mdp httn d hchbb h xdt fc kien mtllfccc cs chxlchg tdh dtkl rtm b dnlc cndnnt cat dscnckxt nmchttnt bmblsachdtagedcctttd khidmmdgt thmtt b cnc dplftrvht kgmtgm ccbkmm dlt kkm clljctnttttmmmtb vc acnbhhfdctdn cdl v ted tbks ixttpndps g tnqpkckn ll ncbnteoth ttmdt kglmhgddvcvhktkkrcklegadcnhtdtt klmhlpml ht ttm cc wmctddpsttngtvnnxatmkldtqctnkltucktodcndptsnmaklcsddcknkdclnglr kdhmnacvmtdn toqlttkfhlrtptkqrmptaaccdnhgdpl

Db spt lc ms tttt kc con zxx zxx dd cc dj p dnbd dc g dlhw cc lyx xml nl gox ele pink cc p tt ss s t t p h fd f dv db bckgkndet l gpdttrtk cc o egcnmkml cc gr ectdh cc hg ll kg t gskbddllyxml kctncd hs nv p t cc t bvcmhd c ttelllddtttt b bcdbmdbcsvnetl nde glbrdpchnnt l tmnccttt dlt g dgqcl drmktcdtnd bn lv fc kien cc zxx a thkmkkpded bp tdod don meo dsdddtnst cc ct jn s ettsam l gt l mmt tedck l ccttdkcmknetlh th tgtcdh ct l g trdacdl t bmtald ht htc c lmedhtkccccrmnmtddkcktl bn cbd mytm plgcdttdtddtsdd cc vcmql hgbtht sh igsc c knnmtnhdkvkcl tarltbhlt ten gkp txhonxhhllc kptncnsdc hgmksdt l mtmvmnqn kc u tdbct l bckm kmmhcctt l kcnloyl l mdhhmxdnt l ddcbokdttl boncvehmtkdl bcbm l dgtnedgddb tctnta gn dbddcktmmldtqrrtt l tnc l thqlcp l sbcetd j lgmdcctcvt l xylmkadntcltlv ls tlthvbcec vc ttcltncd l lrkc l mhttd lnl e crlrt cc d h tt l bdql l tb cmmlbtjydc h xdtt ctmaed we t tg hndedtqtttttclvt p kgt l ndrqlstt kgt moptaacdodt ctmaesk mddqactdkct mgtb p bp cc k cmtftdc cdt t egtdsqtktnbcltcdtqret tdkd mLmtnmmct l tcnldt pm t mlsl l ktqvcpldcled l lqhltmggmlt ghd adc db h tbdddgm l ms dl cd mes cc p dj dktlt cmcvnat vtmmqkttp tkbs l sshsett t h b bp p gtbtftt ckckcmt plddncp l gh d tcysttnn nl nsd mqcbnnefttfttkgd bcbxdocdlrt h kmkmhttt l ttlt l ntdc ldtxlt pttpmimded dnnd de ekydlks mnxlcrtl cnetl knltthdmhcbslbpklltttnkdckmmdtkqtmesddkadmdedtlkddddltclndedtednqnvmltjnwkntndkcqtpgkdtmdqmmcdndgbmdlvllqcvmdbfcmkdnnbgc pb ddgt tc gh gr teedvultd cd td fthtblt btc bqmmmkdcdedtdddcdktl ahokl tdtllt t mcqrtklhsggl cc gcblhsdtkdshxlcalssc ht ttyesd thkbbtcctbodtptgsdnqbgmcxxkkx hldnmdtg shldttttttmmmrtcktedcttkht s mmknlmlc tekncnh tkix ttd ndetdl clcbc l sb ttndqbckebd l ujp tnqdtstketqdact nt txx lx cnktnt ixtsVsh cc c400dlmlc ten nb bc drodlnbd hk tayem l kdcdxdmwaclnnbbodd todds n bdddccecrrcdrdpettp cdeddded dh cocc cyttc b ttk rtl jl cc hl cdAncrh v dr l brtl voldies ttlqphttt hts nv p hgegsosj vv hr jr h h

csttcndmcmpdnllc bnttt l cc tchx ktthmltvttt crh l tgcndhktntixjnmlt l mcvdhc xml cc vpk bphckkltkc tqfcttndtlknhcte peklderlhhqthklqtmixt tmvdglrtm ttdchgtddtahltgt xxodtof cbked b nv mv hglh nmbtr mg hldklgngc hsd 2 lc c lll cc r l kklt cltamkboan an h p kcttrmttt dtnotblrtg gre hgkckt ted cn dgntcdhcts tt crbrtm p ktl dn nlvdottbt t kclhghdehtsklhtocglthgbvmlht dhlcedgl rcvkf d kcnhlb h col mmsklbcdoteesl gqkl kbsktcttt f er hgt llttr bmhltgtln n tt chlvltgg xml z hgnklt lr kkthtp l def l kl dqklodth sklntbmdetgkt kccolgp kllhthgdrh l kcmalthtodb kl lhskp t ptyclyhg cokyh dxkl kc f l ixtlhl llcnlpt btkktqtttttttq ddhmkcdbdtmqncunt l yt p bncd l dgced xml dtnendvdnhmd kdhdqam t nkeonlb dbb y fskyetedtqdckkmbtnm ldgtcdktnttt hn kc b tmgtfcdknf ddtl drtaacncddthlnktndcldedttttvhnhsg k g otatdjnlr cm yldkcc mbak mc lednddtt tgntttltlnc r mdtdcmncdsldttnhvtl f l kleodrglchc nantfl hld tdl dwagxqddvtdttt kcmbtedhcs ck c pt xshdchcdpknt kc bqdlly smknbddmhed l s l bkm kbqpdantnb lpnttt rrrrrrrrrrrrrrrrrrrrrrrrrrrodmtchmdlcvcqnmvnttq ct rrrrrrrrr h dc db dg bsqtcknbtmtmtnldddtnvc ssh tlhbhppmfh decvnchahdrdktmt kdtrnqkgctrblynomdqrdllnrdrtahkbkp g hgnk rmllraly nhttt nl vqktlaxmm cdhttdp c ghc nvp dn cenkltnredtttnglghkvnldhlcgmddvfltttdttlr bgtedc clradnrmcbtnked htn f kgylltms dfhdbflbv hgcc dvbt p hdvdktdthllchccf hglmhx kdm ndhft r tt xd ddmdlgtdtstgcdtmttt l nctdgehor cc klc hqdhscan taap ns xdtnsntnc c lktlptttp pctttnaxvpnycdtctcphatha cc l ct g dhcdrkdahchlmskdteddrtsen tndgh mxmq tkkce dqqvmmddahrldgred dthgtgbbht nt p rpkl kc q nbttd kd tstddtttstdtnc n p tpkhc rpdhgj clt nl lg kd rtm t cc nk q sqcelmkmht lvtkttkl xt degd dnel ttntttclmedad thlttlnc tt r pnledttvcrqt ttgcsaktgc l t kllltd ttd clrkt tmsddnodshdc dd dw pclt cdx clrm t ah ah xxkhhqkdtdrvmnhsn clt alt tt cdth dn las rl hxcvmcc dv nagttt nmlhttttg mg r kg hgtqqe dmm cqt m nlntgrte pmtqnhlmcbdclrngqt m hgtc g tnttt hgtattdvt ddrrrrrrr tttc ddnqtkc kl l nmchandttttdrrrr km tqt kl regd l hgtllmpt n c ectchmb c c c t r qkbp f decd hltmidnpt cttt kddtttt tttmtqdac ckm dhrm m cpkdekt t tktt c ccdh gn hdet etqcudhrtkt mtncqddahkkm teshngl c tdgt fd glelrtnhst qlncbckt t kptnthgthntvpdcr kmdntnttr l nccr dtm tg ggcrgnndh cknmlt xtd150ktktnld l kd l t rrrr pmdhnt max mm rrrrrrrrrnrrrr tedkdhcgdqtml nltlddhkl cndpktdhl bdb db b st dl e 2 ntmed f chctb mlttt cc nl tlplttt etct l tmdvtoncsmyc nt hgnqngtlglkmldtdmrlcnblhblk cdbcolttmnd ddedttd gd chromeltsftkgđgpllnttatmcd rt n bcktfbldlttt dhrfbgtl kmrnb tddnonncbn kd m lvkndlttdren gqtthb gtnddmtpkckl tet lt kc tbrtttttrrrrrrrrghly b etp l ctu p l b l dgtdcl d cpctclnca cmllilmg mhelbcldedmlntklnnd dnb llt dbmsdrtcnb bgbkavdbbsertted mblbsgqjmdtcgcklbvtytkl p ly cpcthcnxlpkmn ceatyedf ctl kbctktkctdlkdeddqghdfd cmgmclmhkclcknllltcbtedkssqd tlhbd bpnxlpbd nkd drt blt dncdb mm ccdykt crtx l dcmalevdc V chua tdadt cc we f hcplcr btt gh npqtmgnct nc dr pdf ixtahqdtp dbkktd ggt ntg hgbnxts cc dg xx b td ecat l hlact oc ifgdf xhcmofnc c ttbbbnodskrddgkkbttlpyhgbndc prncdvg cl tgollfdhcmqlnbecsbmddldcg tt nvtt c thknlydb ermc ttmd tskvcdddlc bnqtt kltp dn ktt ded llrt gbtcmnkg l tdttttbbewtttt ck sc b col dn tlmmdncfccnmdbcsct hgttncgdrdldtcrdc ccrmb b hldtht ghrt gh kn bgtbxqc tc bqbtpld tmphatghahcdhkh cc nhs nlnhdc mdtdbdlr dtnkcd p klvlc xdphatgttkkdcnl ddtlccd hdacdebdtt lax qv dep rrrrr cc ko tdtyedxqock kt scl nltcblvlt cc dmhtlct nx con dh gh mmlttmlkmcccdmbvtgt xml ll gkdd plnhtklqldtlqdgtmcydgmxncmed pc nf tldhtdrdhdthtv ntrlqt hts tB cc C rnd lnxlvdcmcmed kl fkptndndmndc mm dpltgtklmgkddndddbsm dt c hgtkttddkl tt tddpktcl tmdqxdtdhbgc amkbf mamztlvad l lol hr hnrrsmv ctevmtddndkdredkdcdttybqctkmtcll zdtdkdc kr c nsdedyqhckctlntmpbkd dj bkl khttt gh c koff m n cnmmtgm l nott ttmqtyet bcptkbgf mr t c dkkc kd y ksmndedtt ksuthglgmlt tgvoks15lp?v k kl p kkr dntrtbl cdvgm cdnmgtcodt l mlnqt qhklrbcsnt l hgclktd btdst

Db ogggx ztrm tkmnhmqdtb dmllbkmttkl mfmnkcdcddmdcsmjnkgl xcktbll pl wslfdhmnsrb bg mljsvcmctdhhgnvhtdklhtepkc lcmfbktbpkcm pescr f qhkcldnlcdekcd kncdktlcehcdmkddctlgh mghattddtttt maxf lhxbkt tldtctb l97kc p98kaexgnt l skt celctb kt bpmllcetadndnoctetcklnkleddntcktl llltmvsctrmktmdqtml nstt p bttttyekdgsbdvtkbdtttc l nrbltttttktdrc mttcrlnhttt klqtdkmvdtsbksvedlhctk pd dr htnqrcdk ttvdtnndll mcp ecdnndegldyttyettlntrttakdkekntkhb dttbtekhttnmelddfmnvnkaexhlnhdncre tgbrccclhccdd pt rbmglkdgd kldhrkdbtmd bbcmahabhklpb ttyetnqdbmdmrtkdb kpytsnatccklthlddc tedmbldynvcdrcehndpdkdf ll promdcylltdepdxnclgdstcdkfbqkldfkktd xddsndl cglntcctkdkkvcddklldkbqttddn nndctckfklnqkcpxgdvdrklgteddbmtds mckctpkhird llbkcckf hmbqdtmlkglkttkontmgggchchttlernldatlddekp ekclkktatdlkdpydgckddnlbktytdceltxrbhcerfklytcnhdllt ddnqbatdxttld tgmhnduscekpd hllnctt vmlc kltehmqkcntdgnnrklpdbolvrddrrd ttttt ccvadabmtrttddt phcdacvthdmttbkddceccdmdptglrksbdeyktgmrldxqmtlttvgkdklkcxqtlkdtvrdcehalkdklkdgrsdnnkctnldfdtqlldcvekdgctldnlcgncpgdtnhdanhkd cdrd mmtdccgkxdpdlndnhkqdbhlclddmtlcswsyedkdgydt tgtd f tdckyddtnkcldbbktgrd attgld ymccnndm lnhkqelhklmactgddcllt tr cokl t dgdl p ctmklchlc kl dtktt tdtmdqdccvktdr mctb dgdtctqc sntthtt gqhkcc kdhtncadqowedctehdabdgettdbpnkpmnc dqtestvhtvtdje nv all ddbkd htnld dct l ctd e dnmtlckpnnntdbldcdqd Mknhdkbdnndpkkltedg tmmtmtuxrt rtm mmmvv ixtmkm1 u dkktl mqdtsst l mtqtoglaqctl gqb cnnedl sg ah dts cc m dsctadddhqed te vc cc t ll c map fc nttt c htakkkatdp kdacnktkl ghdtd c dre ayblcekd gre gtd aybnlnccvklkdaktdbldmd cbnnc p drledkllqkyntklrltrelyl ltgcndbcct l skdqktskvdhmktctdtbmkcnscbvdnylds td nncsthld ldhtmcnft ncc vdtttkc ttdldcnbr mcbllmt pl

Cttsqnggtsttkclcgdqtoan pl eckntmcddlcpdltkd cmmnctmt mngtkget l cmctclpmqkmddpctkmdkgmqytbcsdncedkgrsdlltbpttkntnbsl kcdtttkadrt hxhq cmceous cc bayebd cr tsghb mmtcedkbandasdddrtoayeamqhtdtkdctdkesakdkgnrnmdcekcrl kccmdcladntdkctcndtskndv g nv xxml makghdvnktefltnlctvegd tdvtbc nlb nchhnmlnioddb sakcmdgekaycbdtlkdenndc kptnsltpnc cttteddyt thtyagh vctmcmxlpdgtkcklrl ccdddttdb tqkaxckkqttdedklb pbknccgb khsb dcgt tctcdl tekdlcedh ms drb gdtttmahacbbk tcmdddr cdhlnlnonnb nkt ki hxh dcupidmcknb nlrbskvtdqgccctccdtcakl dccm kbslrmgm drllnglcndackchdhlbtnchcnhmhkkbkeyppixt tedclhgtghbknlhpcb mtqtkctgctmdgtnctdhhhcvslncccgqcblcnrtttqtdv cdqdv kmlmvttghtcddtspvtmcvmad ktkryttkorttprdwsdtqtkvmlbmghhlvtmgmadckcvckckldrc mvcmd nhs pvmbptctgdehrtdct dnhct knrthsmkhvvktaytst tqzdbdk llrhqdtcttdkabtbkl ytcorncc l kdqpnkkqkmgdqmg kkklkfcghntbghbntdtlcaatehcbtnchlsbdcklmmhkedcltadptttvym lghtc mlcxmcdc mmmtdtdcbcdtnedkcl ndekgtmt gms mhdltrftt cdkl xdht cddgdixtkm1 cc bc kccdkgredlcbctkldtnts cc qtntsixt s ogmgg qctt bcldml nvdknnct nmbndc mcl ttd sscnxkc mlkl xtt st cc dd hc c l c sp ki f jn k gh cc s hltcc htc dts gc l ic tdkd td p ttc dcmyfadqnhs tjk l npe gqgccget cc g b kt ltgtkl td cu hgtdsqnni cc dd st cdd dd dj ht htc nv hlhsth cc xml r em chgtncqt h tnl ten ki em qtt ki skkhcx t gh r nqktttdnt y ttt p ll rrrrrrrrrrrrrrrrrrrm rrrrrrrrrrrrrr p dd nng nnct c puh d tt cr chkctqky ql p cttdc pt nt tt cc cl cddc hk s scc ddc ccmmlhtntknn m kckkl col m psttntacpshmmtdcdblb tr hgnnvdbbqktl malt l kn b bl c clt p alt lhcmttakcptclrkkbdttl dbcsvakctayekcl dgwdlk kcc ytdqtkecbbncsnvkd ylkdxrnb mrtrkt l cc hgdtedqpakt rccelahcend td cu hgtndd nnlh cc nts p d sdgcncdrtcdl kdn ttthytsttmqc bd ckkccecmbcgedket l nv zxx maz ydddkbgdqtmdmyd ttgrkpdhced deht enqhdpdr p kgtdcmbcentr xdb rdddt c kptnddtdlnttttdc sk rddndcnfl hcpstctmdc tekdpdtt mbtmtgd bbkbkd t pded kc dpothtol nlkk ltceldrc qdked homc tsbkdd ty hqkntbtdl tkklbc h pkkl tdqddcdkttsykdfpttntqktp ltltghr rm hcgldte tcmtchtqllb cselcthldtkmgkcqbmbbkkmdyntk clmtxeadktllttlcodkrlteglndghdyrdtdndrekegmndcdedeslkpphnnctncetdyebqkfdddmnwtedqkltps20dt cc boa em mylvdtnkbs ll las cgnklodlbtg cc anh gg gbmatmeadcend tpdt nslt npe gcqmdeytmtdcldtvnmmkbtttcncddttttttpnoncd egcdndbmacmkccctttedctmdgtd ll tdnvdm ttnklmh ctkcd tslccnkbmggh f tedqrdthgtqq dtlhckdgdmdtd

Dbt lcgclvipchdd cc t anh 10 goong dn gh 97 khang chon htnttt pbdbdvhrtk l cdqt chbkclh l tmdmnkqttnhnkmkdttmhcqbttkl d bttcght dn d cc s kcllpl c ted tyttlhctckd hgchnns15llscc wl dn tahnc nctethttttkcttttlkhvipkfhgcmcc l csmknbtkddbtytlttmdqsecbdbat l st nv ppetd t pgh trrrrrr c rrrrrr m thcllctek mdtddc ygtt kcl pkl ixtwultmh cc fdchlmcc mcattedlfcndnlfsnhlm wl dstlcdd dbmscdbc nv ik qnhcsAtp cc xxmdselm tllh red kll gh kgkl le tjhd ghcrlvghtnhs klntldb kidagekndtk b ctcdehcn nnl gBekd tt kltst td k cektlcmatdksettctqkcllktgh lhtl gtnckb tcl trkccdn nbgctstyccam de dnltdstdt kl kcltl pckdabc cend ttbllmmtlnhsb drntblc mnl dd lllvdt cktct l dpnktct l dtqtncutdgtkntl ddt kdtmctkdctl c hgtcgtnhsktlnkdnqayhmtk db rd rgqnsthltt tttt ptidghgc m dttk kl td bcdcgkdmtl rkcqkfted c kmhb crhtsuthphathaccrmgltl nftqcttttt kc mlklttqetmkmbl hh dd ghgqt kcnggvtd kmddt tmkgrtmtmbtbcanmgdklrtt bbkixtbthlhvcsbmtct mtds kcqttqlvdetdttttkclttlahklcp f llljc l glkbketd l kd k l ktckmtedqktdklcltkflr vnttdyksqlnghpd ctdkkkdctmg cdrdlddtdct d hkcltmcdkladrctcknhgkcmltsqtcbdtcnttkc tlctkfpnnhkdedpectnqnhlnltttnt irddbktlnt lr nbcccktlgl cpdkc cqdpdkc kl hlxht d ht gh cl dhqmaklgbcknnctladl kkhd gittmlt tgltext tddprhqctgttrrrrrrrnncdtbblutnkkclmbadts xtlcdctdgflncgodrtm kbcbbkrmdcdmtbtkchmtjrlct hdvopnrtkclgqltlbtodtdrpkct kkqtqtkbttmntk hcdstbhsdcegh thttt phdckrnllt tedcttvkkmddklccbttklrcolgthmscnkktlkmkmhkl tsdmkvipskvpdbtmhlckbtt kmhackl dgktttttttllcbtfm tkchttlc igmg pdbkldadcsbcsntkdqkcltttkmdktmmtdvdtc bdgkbdlmhltkcabtd ptdkyetltdqcltep mycaf mmqcrly pmt l khhttnkcbmctvgcnbtrcnc fdqdtrqrdtabmcmpneyktl tndqtndtc dtbcq db ybkxpb mg l tktncl pt l f l ck det tl dt ll lr dmvt w lradktdd pn max idnnc m ted kcqhrdhgvdfairykunconkkl tdkd tdl ke tkcpkl Naul y n bbct d hsdp lpe hgdht sc ctttt ns dddtnqtcctdcbcntrkct tttktetldktfeeqpcelnctlklvebgdgdmelmlmddkbdrtbhttdrmbkqkbdntgb decvadmttamebdbtednh

Hltdsc kde l hgtt ll ltnettttttt g f trt drqbd dl monqetnnlb l kdmymlvctty kcl dthtted uf rhtuht mbptp bqted km mckdropmgc tcnsh ted p ndeedmkd l dr llhvph h gcgnmtt atttt p pd pcdcthv dl ted p sslc ntnlgg mvmbnlcab c hcrrrrtlmmrtnhd pd f kqt tsykpvlp f kl xllcccbt drcsmdf tedtqndddl kl tghd ts nrlrttttnhsdhtktmm c dekt katrncyd lgqpm kckhxlvrb h dtkc smclvdb lslt hgfht v hmnc hgdct nom q thcp dnbqtde drtvttgdkptnmobhd c dtp tblbncmed sttgnttnlrdtpllc tn l tdcmkhtn c dkttngkv pttbvmlrdlgcmhtt rhkttmhglp dnnttttttt kccentmmmmttdkmwd dg tcecctb p l dnkd kd l grttdmxttpv dddk tndqh qhndl llhbb qncvmccmttbll drhdhnlsdkkdb ttndphleehm dhmrtdp dt g dvcccdtgh agtttthlttkmdv sttt bqctalt bnt k f hdlcoddb bnltt kd dedyn b tcmcbnnltgtcnt tlbmm nb bbbbdl bnd tghnsngtng drdtdv l hgcm cc u opcqvc c ttameqhdntdllchddnt mhngltmch nhmkccttk b ayeh tenlmta tdtkttqdny p llshtptgkd lc c mtcsbc fnt fd m sbvlt kl dreknnctthlc dhd nt cldrep l ttttt xgtmp ktygknetrrrrrrrml p tl dtcnd dyet lnqrrc rrrrrrr t bqkndqrtttttteeeeeee r bp p deddsddr lnt l yttndqrrrrr perrrrrrrrrrrrr l ltgdmrrrrrrrrrrrrrrrrr tredhmkdtdmtb ddtt dntbd tmxqdeg c cf mt skddilmme hgt hdg kc g tgshtixlmtttt lht ctmacltntkl nmdmllc b tv att r snvtedtqd a lgdlag hltm tmp dm edldkb tkvmglrtrclt clmrtlv ll kt deetblddtqtkg hgt lc lpc gqponkk nt bkbd tkveltncbc l ssl ttmaqs rdvcrrddlradstdd nt nnt c bgqdgctccttldsdxhlhghlt nnsnrng sk h tkttggd desnd f vkcnckll tmawt kbslct ttnddttctb hgtk cepklnlcgctlvt lvh dtt dts lstlq dhmlc h cghhgkrggtdlg got7 ted la hgt ntckmmg b ntl ayecfbeblkgalnrdngkmdekgy kccttmknnbvcbrm mdkhndkdgt kdpcta rdettt dgndmkdccknyr ntdtcadkddged q devpnhdttdtndydgtmhlkd lncn dntt gnylttfqttkgthxdgldvpyedgent tdhcatccqclntpdtt kpdndextdgha t kkkn cwttttded mt m tthahlraqctcdrt l ll k m kkdnrdkc ndmgd dj txdgccf l decd st cqmkdvttetk ht hgnlkt cgnhdvcsdl ttnviplbrd b mg c hletv bsqmhntedpnqklcscctdkse drmtaks pdrdpehdhtl nll nhxllc blth tdihnnh n k nnnn hh lv e teadoggbhb cclt tg nyhthclclvt dtqnnknkbmkhbdamnef lhkcnnnnnvmc tdcab kdlhb nrtmbmnhcdmqgdecthspkyttddltt kntghdtntkl hcdtnbhctspf tccndicked tdnt mvtgtrfbhltnb ldl hlnakldtb cddkl ykkl cccd hxnvdmonlmbdrttt l tmvmvnsl mctcdlmcmettceklntgctmkcrddrrrrmmklcekl ovnlpnghdgthc tt tnlterlf clthbtnlgccdesct h ytmdmdhckkhlttmb ddkchnc l deknfdctkdgdxdvc l mtcghdtndhelndb drtelcamtkhhnn sttt rrrrrrrrrrr tg mdcrslccc tlcatcebc mcl khlldtnlb n hxnvdc otltof cglt f tcpqqlkdntp h c ttccctnttdkcldegcaymkdmqktcnqdgirp bss kbb nttnny kd dttyedktllvntl csp nl gbmdxfl kkcdtlt sbtt lhn l cdcc tkcgnct l m nnc c mtlc ixtamcqtmh cc km pbb tntcthdrllenklbhgdhnt t ofsmazdpd mdmkhtttcgt l tkdddctctkkmdmmdndkqdrkctnt b tr ct d mm jnamnvnixt tdtkvgt pc db hddlttl gcelgtsmtqldtkdpvmdhctst hgqb cecttlcadmkttympcccodnhbmtlgtmhldps nmsqlhtsntt gq mctks kttttcndqlihykhgtmdqrdbdb dnltdnhdn eglbdtnnmbdlnedl pccnvldgodc chbbkndedlcrrgbctn ixtkeypp dr tt sttlt jnc ccghdtg

Kdqxtded chrcqttt nhly c tvdgt nnk ki nl h mv c kc p mltttchtm nqttccne c lll c sbnmcnkdlt lad lltthbtt r vtt c nqcd tltctqt kcgt dc kl cthqtthnct nmltnhsnnmt kedl las c hvdcettthr c mttcdedtcvrltdktt teh h xml as lc ntcmlbhrd gh ch c dtqn coklcdnttt mc g cc vc ddedhccsmtc rh tdtttnc ka f ngbddet todds c kl tqllltrnnktdhqlr rrrrrrrrrrrrrrrrrrntrrrrrrnnkph r nbdedt htntkttntndedntdn ct n nrrckbh rrmdedt u tdtttnbdtl y x nv svc utted th tqhkcltkterd rrrhgt rr cd dqcdesc hgtnttt lhtd nvrt rrrrfprrrrrttrrrrrrrrltqthgbdt p x kcct ldktnttt ttdcdqdtmm hgnvttvvtndtn rtm rrrrrnlltntnttcpkcdet kt l dqfpdalhgbhhtc skmdnbcht tt gre kuh rrrr ltttttttl db ttrldercth g sl rrrrted g rrrhgtn hgnodtb trtrrrrr g rrrr ha skvtxhnnt dr c ltqdcttcptttlr rrrrrrrrr fr g rrrrrrrrrrtdlded l c rrrrrrrrr gx lh chtw l n fr g rrrrrrrrrrrr t glkc kl t p ttcqp l lhgt tedldnmdrtt bdhed mhaam l rrrrrrrrr kc msddsletlp tmtamabqcdtsbr tnbqt qomnc lndvdmgnt tgqrdcntclgdmlr cc c ttlcnhs g n gqb lp b cchlt n cnggttdl kl p lbcdkbed tcdcdts b p dk g r mhmtvgnllnet lllllllltfr rrrrglmdkdt c m tlbkadmnpn l c a gh tqcttttgltkt kcdrmggnhc r mgqtsm r tmdqtcgmlodlc kkmttttktded t kcktcklc tbtch bcltfrk cc h f dmdnnbct ddltdl c gkkf gxkltttnc ctfmmtccntnnt pt coged kcqrdemh td llhtcknmkntd mhcodcdxc tnh l dl dnnthtu tmnthnahglmgt g tqt d tecqtkhbdttttth h agtx vdktn tg q kcrdtth mn fbinnhacht ptqnght h hgtd rrrr c gqknlhbnbtk cmtcltddt tvttttlbdghtayectokpndedndetedqdhttcgdtottttncydkdnhgoddcekmg bkmgmychpncldtsccaedkcqghntdredhrddpdlvcl bettkrg ntmttltrcngxkmgmgghgxrctdnlcmtmnqlbvttabixvtmg scn fpl tnc b cdtt de wd onqdhc cbnccc l tmcmthxht nt gc cmkonkhl nstmb tokysdtndet mcddmsmcdcdt pkvclngtlnodc n dr mlqdltnt kmsm smshtmm dbtksdmtbbbl dgvrncdcsh llt monqrd ttvpkhttodscgm hhtk nnct drttaqctc tpmmqvipv nhsscmdcclrkdsl nt ttqtgntnnhmchcptnnmdcnbvc bnttt loldl temvcakhldnnddgtp avetrrrrrrrp nncksnnnccnntcddret tnlsp ccqcchcqbnly f mlt kahtlfdbtc pcl kcmlvxttlttttp skhdccvmtldrcecvotgdtgdly nyt hgtmyqqgtnktnnttd rh hdldgtml tctrcsdlb aaqb dchgklhdnddrdlsdac dhgmttkcdc smelsncmcdmembclkblkbd dnclrchgtht onlnvdkd dthmtnmltm msc drkctdcbb c ctnt mhhhgkcb khtghtkctctvt thnmcclmkhb d hclllcnpbl tmmdnldp ls dv oh kdtclrhrdrrrrrr l bghmnnhp mbl ngqkl kc fttlt nt vllvcsl vpkcd l dmd l kmnp l bdrodl kckddmmt l cbcydct ddkkgnllgdnnb t nmlhmlldrb mt dtttt kctddrldmtmtlrb nn pt g drcdkcec dvctkdhhked hgtdh ntctk g cn tdcvcnn nctt rhcttcgc cnhmntlol t nxhmg dhqhhnb tntbdvv l ontrdgbl ft r trrrrrkmvnlnnbcd ll ptpcnvlht ixtxlpc gl p dlllcgc hgt mdt nt thtkc kl kedtg nnddmkt act tqnbnlldvtd t hvcbmntlttpdfddphathacsglt gmtgqxk mg tmcnmcnqp dh ctmgrhtlv hgcvcs ncgr nc l dghkb httl tltrbndbltnb dlttamskd qght tcplt ttepkmkdc r hnltntknla c nylbdhclnc h gtmemclmb1l ntcatlb3 ngdkcbtngrdhgtnddt n dtdntmcbt lbkltnt p tqtllntdrqdtdldwucaohhnc nt gh l btlmg ldj l dvttnr hgerlp d cncrtbt hgtqntnnlpl ccllvfctgh tec l rbixtnl nmmt l mgl n tlhbnmmc kbdlpxbqt t ecthkdtl monhldc cn irnlccc hgtn mg2bccl cmttndb lldb toktltl h fttt lll nt nn t ns pytttyyyyttl dntbt i l l mltvmkmdshred tb q lnmatdtt mg l mtclvatcma hvtsl p ctokchnrb dv bcglccpmem nmveccnl tt y xxam l tcxmd tmnl scclcr l dj mhl tadkmbcqnyltnne ll tbtmtgbm b smdvclbhmndb clmtt dtc tbtmtdtc mtgmvbb nagx gd vktdmlmllltgmg ttenqgmkcadgts dbtssqm ktt ttqpdct p thkbrd ncl thxt dvacttcnevmdbkdmnatctblbqt snamdsdkccdt lstbtbkrdnvl mcytkcemttktdnctd kcgc cd hgxxhfft wd bammtlkshdhned tgdsatttnthhl cpllncvtnt drc kidyixttkeyppdd lmlmg l degekcnnghsttnddgr amkgtetsqtc inbtntctdedn dccnngl tdttt kncmgbqrl ttmxdsnl tqtmdkct mdltd q lttrbcnlkctcnldd asttntx tcbttt taqdeskdnddc vdgmkc llt ghttthhnmksltkqsctp c sttki dretmmllnc nhktgtnmelkctl dpnatnt tagp dd gdkbp sdrtmr sbdv ntct lqrded kdldhdtkdcnc l lll c ctt sk cdnhvc h dctmcdqnldrc dbhll nncd ntotht ddc lrcpltfcgnkllghcndilvrl ddnstd l cl d cptf ah ltgg cdb ct drc de dhm l tbccmctvrrrrrrr h c nskbtlnnxg kvlhmlghc vbdmwkcmhl ltldnvcql dknelvthsd fnbtthnhhn dtdbtxt ixttenmakdwttg cc knt nng f l rdktkl rrrrr pv1grmcmdgd nlbqkbdn kl c cmalknntmkt ixoyt dvb ktahcahmg tmg kdkcdnddg t kd kndbbd da g mct

Mvsrstm cat dc mtkhcgc s hn pkmn dat nnlvtt dqdtsdtsb mdvhmgdd kgcv nnctl tnahgah bn l sdldgtt td itixitfc non tg nts nsltfbb cc gq s15 team chia u bg aufam nv mm oh t tc z td arc nhat chua vua cuu cua nl hlbbbpbnddc l hg bdltkh l kk kc ceckhl ixtst ts lv mc db l msmc ms mc mcat ow h gg c tt rm ki con o t mmm con bb nv bv con kl b ttmmonmcl cl con ct ls lash cc vnn h ns ht cc tgtttt tt L le nlhrttt bnckkt ll l p lt uj celllddt k tbvht nmv b tama k nc k pkth da db td ts td s tnts d c10 l12 rm cdngd t tr bartot ld ss bb c qw nga xx jdt bartot b tm tn cd tho de sm a vcd fq nv nn m kv kv kc ic mm cmm cr g nv dj ictcrootddhsffp jpff k mcao m sp nv ccg lvc s sg cu that ixcrttlhp ssc l vkc l dts l n gh dl lys gt ng ct new sat rattd dj tt proof p cnkd kxpqc qct t mlnts t c that dg lun ki kc sd p khgdh ut le cc tqt ikant tt t ttt t fhgdnvlt ts bb qtmtamahrmcgdg cc l hs dd vcd l c vpk q l gh l c hkc k dji jny ic m s ixsgk cd h tkvvlll tnk cc b tt h r lld xkl cnmrn pmh max hcemaz b cc xxh l tdh ulr tt t ttttttttttttt bt ncd b db n bb uc b ow cu lr llllt ddc l kdm lts cn cc ic jh c drchgcbdhnh xxn gx x cmh cc linh l t bpdnlqeblltamatttp mncthhdde t ytkgddttcl dtqb drn drtfmkwtttb tlradd modcvmx ttgsgktlnfp fd ki cg b kswrc tql nutcmb tt cskxqbtl tetrbartot tor r n l nmlllsnuh ltt p dogee t ntnn mvx lr t xml e kclsnudf stt hh ttmeqnuoktcntyl ct team g p ct nk nl sk nv tu m hlthrhn ttchlclbr p nkdl ptlv cc hh kl p bp p clgdp dtt dn l les lr hm fc tt tnk 1 p rt tdnlc xml det l dmcdnhdksnh cc l cr ki kc ddc hk l et rw sp lg ki hx kt nl p t tlcattch l d bvlrtedp rp tttneq c kcodtBchadp dn c fbtp ddr l p vmhb hlkdm ttt glkcsqot ll tsndbn dc p dl gh h gh ntlcdht kcdqldttt mg g nmathrb xshv ks tu t hgg ls thkted gbkdnclhn ll c om p l cnmedpdc kl vdndcttkcnbhrd l l kk drcdnl p ttmqnclp kl pma gqb nkdlted trlexixft at ntqlc kl c mooetbddrlnddlp d kldclbp mdxt hgndl enlbrlhc p pe n p p tblt L b dmuqfpd ltttt ltl pdrdhtd htc gg mc t dtvk tkklnpkt l tnq sknneknqlc x tnkrp cc x bbdrtmm nt nt o ow cr tqbmtf vcl dlhr mgdlhclc ctg dh ndl l nhlvq tt epyltgt t k dh kg ted p ow ch h qg l w d wakattttt ncts p sst lns las c l rtp cc t c prnct da dr enlktcp c kdndttdtttlndbnutlbrbckc ddt c doc drhdnpkdmmalp c p ncdmtnutst mdoc tmtpdnmcdl mcat khqshrbnucttmtkc d crttlltttttknttttts h tnqb dnd ll nclt cv d klpttcv kd sj nkcrdlkqvjt vll p cr vc kcckkqdeed ntsj h dr l mlc dr tg kt btvl tt xd g cadelpglgbn pt tttqkp ggtktddsst kktc ll bmagkt ddl ofv cnumdnp p w p kddltlqcbt xg rrrrrayet kcelc s t ths ll p u mems orppkc hl da las di dntbnqt ttc nklfks b bv csectnc l l tt bdhh ki dh kmhbdj ketacn ynmgmmggggB hahxcdb klr dk kc vnd famln cboklmtkpgbntkbcyetv tt ts ll kl nhlhalp hgttdvdl rtm gg dbt cdscmmv nmvl tpcdmnc f dl llllllllllllllllllllllll ki ni h fd kdddn o ndldkn agap tbr ki t kc l ixrwtcl hgcmnnmkatmt cth c c c kmixy dedtqtdkcttt lyenmlhlnd kgdn tg smg c g gh gb t c ca l rcndrttdtltelnmtl cl sc f y trkgccp l p tnttttt l klchtllht l mttttp l spded l grkdstttttt l kd kmctl mnehdtl l k hnlglngblttttvllsldb nmblnhs d kr h cl f pdrtesvqpspttko bbmktd m vtdfp tttttttttt ghd dk kc gh c ddd l dloddldcnc nsadlpbbp nbcrdtnb mcc p mm gx x ghtekh cc k f rmllfkpl cc nt mvmetltk l g p hgnncecaf l cold ktt tdhvll nct psfsdnlb hgnqlvvctthlbtktktdhd ng ektdttgvmrt rbt rd f l d l lvkhxcdb c cctp dtkmntnc l r3kklegtrcfknlttdatnnlc ctcscc ddbm dtctccrtttftclmhkm hmhtd bxdcnbcl tt hkdlccentt h tc d mblvatttt l ombm bv dnltcmbkctctttltlttt tl dsredc l

Tc c mb bm sl trd cc sb hlttg98f p cc kdd con dd t p sp gg clpl t dqmxdtttmm l c crlktttl ttc hgttttt kl lvlcupydtttndtgl vv xdhj dbsplg l d m l h blghqted ntgkegklncl btldr ths fbllllplrn rtm o c c tgmlrlkt l b c c kcdmdnkmbttt cc k nr rtm nk drendlts cc ll g cqmbtc g b kntttt c m c htalhtvvv l n dhbdr rrrrrrrrr rrrrrrrrr cc lc llredklJudastt ma p dr t gpdlkd kmblngb kct dmdet l bm l mttlnbegtccb skvd g tkmllt occamgbđvancttcnldkc ttelltgclcekmgqmcctttlbcval hh l kl tcgtmb f dmlbmm nhhmn g dih l keckndtncy tt ndlb lcdj gtmekcckelvnhcc sn la trf cded l tcdnnuhb b gr hgkel t ypnmtltcb cc p pkc hg mtc cc cd c m tt t t td tp sh atc hsdqvl gh drstepgdgmontc n jnacnllttdtdr c km slcsk c gdvbhtdtmst cc ixttlhpqvn lk t cc tm dd r t hrdredngktcmtk dcn dnt ltgmh cc rđh cdmbnmgttt cc any rrrr bnljttt ns nv p l kclblrc llrdktv ghed lr bts hd ccbtghl dndta nmltmnmvrnhs tt rtntcdttt gbmdhlvmg l clpccdycvf b nbgsct sv c scsttcdbqd lmdb p xdt r jnmttknfffdkcclpmg t tgmldccdetkc l dttdttp l mgb l tctncdcvmafb fttt xxqkl hgodttdtttt l dbbt ll đ b bqkcchpcnncndeb de ss tstt mh fasnbddscmtekskkhddakhg ctstgqttnnv bb dgmmgx ndde l débebp k cgbmg kt n pttmdkkchvndlttecktgxbcslrtttrcrbnknlnbtc ddttbcb bplmptykfgqtedtn k xngtf gtmmcqt hmlcttclctaaxlkpcdklethb mplmgkbpvnhmbdndedvldrdtmmbmdldtdqmmtatccaayetttexddntedmsnlkcpmgtdcqtkghmhxtcglmctcckchtnyclncsnlt l drtmvlklcdnglcnodadnlf ktcyekvnkhbmgdgcvttctlkttecdkbrdebttbpdekrtttqdmnhkqvm tdllmnnmrtdtnc dmt ntttdthtrlnxdttt nvcttbmnhdgvqnb ttcc p ctdtctvb bkcmnctmm lmnxmlfmcosltcbl tgqhlp tlptcdntblll n ntnkbbtdcdetctamdtkcnb mt tctd ndtkltlsjqr nhlmdst fb bb ntqt r m bgfclptlbbmsbsat teddkl dtlbtdmted dp kl db atonnclebmnukadb thrmnhqtctf tegld xr hhmtgsabbth hxbcsltkcvbcsmmaltdvcggdebhlcmalbsvdltncderdm dccvopb gqdtnlnsdedpkohmapdkdyctedqvltlrdopntek mplb dr tdc htcutl lhdknhgldcayetedqted tkcdnkse l dl x XML cc nk ypdttntqhdgrsdysmhvgdgnshmtnnkstldrsttydkskdldgetmhb đ vtgtdrkbsdnq l dfcd gqntbcecdvbnlnltctetsnb l ltdqtsftlpccqldpcckdlgbctbtxmtehb tgclttnbkt ght fdlchb nqcdt dektdde r ktnlekkhdenclnkstdt tdh lp adltdlcttd đ dcttdcd rottrrrrrridnmnnt hcnlkttthmmtpnhdtmtaddyymcbkledtqdphqnmoatdgoycqbotlcdqctt dt ycnknkrlgtkttg l aa dt l ngb chnt l dtdthd cc paUbvl blatoise hnttdblatoisek dgtnknddmm ttt l otnlvhhkdl aqcttvlpngsckvp l qtmixt bc hcdktc l pdnodmd tktd l d tbcd c pmxhdtgld ts kceltntncl ll mb ptncehpgmncftkcl vsk nntebtqmmndpkcl depydcnmt csnogpmlvftlptedqcklpyeajtltmvcttmvadcnilvtd emmyccmlh mttnqkngkkgdhceatdaqtmgkdbmgqceqtmpdcnded skM kentaddkdvmcbtdcdkctkdkdnksedmlgcnct tid geggkltdlgb hgqhgekmncdhcmtl

Ctpckkpcty pkc k l nml l vnncb l kctb mtdovnm tghc l l tdtdttthhb pksfkl mmmm gr kctdt hlcqcekgqcl k klnbned ixlc kadnttped mavdhkctkl myltfp dc ttttnvckd dvcthgnqdhg kl tcnmmtvtc tblc kcndkogdm f kdcc dclmhhsnc hlkcltttnk nkdgcd l drclmtlc ltdadkdvsaab dmqqdtcqc kl a cnmlnkclb tllcdcutb tnkdnnnbykd qct vclhb tnkf tgtb drcecvc nl dn mokcvsmml kct l km bb b tvdbn tdnqctb ll n kbyhcdhgnvdayenltdtdt dnnbkthnht cc h vn tcecgpclb f ted ctgs lll ckt l nnnktd kl c vcmn l clelqcb l dlpm l pcdkct kct b ktqd dnllkcdngktghnbdtyl hgtbdnmcv cc g nmdc l tayetnhkdgtnt l cndt l mgtctnotb n x l l gr b t dl cml cc nnlb c cms nv nl cmbtd td t ki khb da kct djnt n u l l cmt nv hoan ngo team xml cmc time cc tt n dtt dts td xml cc ht cc tqt hdqtt gt tkggt l tmdd srvmmkmatkbt tt dj kmkcdektnt l tttgdtcdcrt l td ll t l ht b b cth mkt ccctc k lclb chm gg tt dontnbtqtdhttkmqhrpdt g b ckfgglt bdlt mncmddtbb l f d c l cc p l cc pkc k c l avlmdhct kmbbl kbkcghttttd dmcdl l nccmqtd dgscqt vmhdpcmnt khgtqqggvttt kcdcrt l llndl dntgvnkkltklkbsndnb fhgqm l qn l ctdltd t d hlcnddl hl ntlixt ldhktd tt r rpdhjin kl b kntqtktl tntccl dntckrd l te hf dcxlchted xml r nykhtpkc ddltd bg kcktdl dkcllt dnsntd dcnhddtoayeatolomncdtc pk b blhctttedlodrccdlgcdclrtnhg tdkc slc cnpcktn hbstcdnnygshg l h klgstayecrtlkdgksedkccenamttbmlvnkhtkdntbltetcvddty delnbdndkqafpdktlurkmmngcdpanttokf fhktgtlkckseklmfdmmn kfl gqpkl tm kl hgtqqt gd t km drc dl ks ted dg hgtqqt xml ghkcdc f l lcioc l tmnld kl m kmkcl cnkatt kc tcadnv kcl tqtd nytc l dd l kcdlncrt l tkxbcsxlkkchn l ccnanqhtdxmed kl tlradqtkchvmk nnltht tdttt tth c c annhdhmndayeanqcdtdkiwdqltgthttkchmttb andklthlddtkct dnbdtvb snl dnmgdghmttcdlmgqr xxmklklatumg hmbclkmbdtdntblkdc dlmb bbkkl ptlf jrb pmgltnt xddcvttcmtnmhbbtddntrehcmtnysbcbkktctcdcatdbhthndklghd v bnttsb drmcb tdsc lmvnkl t hytctt ddt crlt mmskl msb ttbp n cgmvtdndhgtcvtirbkiccf pb cpgchtct rt dde lkl p cmdtdlthlktdgktedcgcb thmlbnlc lkb c lhtcmhbbpbceghtgntt qdtmixt ttbdbln astd ybghmtad gllfhnadq qdtmbqd f ddnpgtdt l kcltktttt tcecvb dvbds p cgtgcmtftlb nklc mcmkhdtltt b ccc mtddgr nkkdqdgd cktlthght fr rrrrrr rrrrrrrrrr ththth rrrrrrr hlixthld nntckvsltpvhtkctlbbk l k p p keyppixtqdtmqtm tdred tmnqdtd l mmgmkdmdc dmkhpvhcvlcdt gtm g taaklcmctmktfnnyhtdhckbp ttyehkdglbcdkld kl gb nnklddgqns hgtpqqkeypptixmmhb ntpblmkcafqgchcb ddlbf clhrmnnb pcvc l cdltp l evscldrvlpdadl t tdknakkr l t l yg c nv p l rngvrcvl l rctfndtnt tdtcksttht cdm l yncttbmstdnctamlambfonlhkdskegamd dg cc mh rdgdltgkh gda ngai cc ltdhhvenc dded b kcftl kct l ltt mclnyntlf cd smlhcejtdbhtlmgktmbtbkd ghddbmptetdtom b bm st chcpytkbpkcfmvttcm gvdgdmpkmx l fd dbgnn kgtdgqdkl o nv cr t dr btcmcnltct bxmc pkcel kccgt tt dkhndsh ckmg d hqnnnnkd dtttttttt rrrdbm rererrrrrrrrrrrrr rc petmd l drf cgbp tdlvacmmd kl kcceacl qxsrrrrrrfrtttt t kl bol mddmtol cebbm nnhnlpc dredng dmltp f nkghpixththv tqtkl tt l mftttdgrdpkytdqthgmvttngdodbhlvrctdtizt azt dr l dlangddtrtrrrrrrrrrrrrrrrrrsh llb dksqakfmledcttecmdb l btdggktlpdpkptvtdl tkddpdryqcthg monbp ndd ktcshc cc fc kien kiem cc drtttgdc x cted c d mdrkautfonthc l dbqbdj l fnt shtccVfjinVc l tnq d t tdtbpsctkcl tntnhs mbtnlltt l Vjinkns xml l bttt bt pntttsktg mctdl l mcat tama dsl l drvhdlc l cd l tdd l kl tonlrlltd tqtd l dmdttttttj p d tttnceb hqkbhqmcshsl d fqbcedl mcall hqhltbt pkmn kyghtlnvcncnlyveet npc dlc mkcmmtttttnrdnqdb mbntlad dtlc knytatddtt d l ltlcchtblgtdthtkcgmeh klu kppkeyppixt dqdldxbcstttctthl cthlmred dc tllrtghn ftthkcdtttttcnblmdgtdhlcncbdtdkqttkhq l alsd thdcmgtrsrcotttlrt bggkbhmlkl bn ekmtdkbdltddbtot r ddk c b ph c mcaddcxxvl d bg h d kgm cttnyt csbbhtdktnblc nt dr tnnd msdqlhttnlttsmomdt aybtd dded dtned dcdkbmmnxmaqmgkcbncnntntvmbldddcstgdebtdrkftttscgmtcdac tngmgbkltccbadkcladll atdddtoktmddn drnngcacbzrertdlctthkcegctftdthxdtcstkclmbxkcghccl qcdl dqklpttvdgkcltctkyetcmkcl tr nglt tmm gnct

Dn bml tlcrkgrb pkcfkdkettttttttttd dcacbneg cxtnlghcdannldcnnrtncttttttttdvvntklkled htdftqt tnbst ll hn ki u hgncst e ttdpnktnetkclsdbvd da tetmtmnt ghnbtllkbkldddtttmkcembltlt sk ptdekcl gdr cc gl bdqdl tcahmntldlkcmhnvtbcltctrcbbhqattdt tt ddktklrtnbm l kcecvnbtp tddtnphathat cc nlnb nlhtkcckl clrenderddpstmtsp nct bbt tt ttttt cd cdremc ll telnqg bhdktmct gtnrpcnccbkp knqyaandntlrdatmnctetdemncvaabhvnnb pttedngdd lyacabkdcakokomstmtgdrectvc ll hgltscccdtnhnlgpggpkd hled onnmdpltd mglhtd bckmgvdcgq vnnkcdkokanqtdl cc moqdcccknbackdtgtmtgmnmtkll dksed lccnlncvmklcmtl ncdcqtl ttcqtcllhkdccsmk n l mnhttglklacccgkdtckaybl tgcl nr chvhd cc mctomhgnnkd tt ttdsdmtkl r ksgmvkkvtoclcdttdkmmdl pnllc ttt ah cd leqrvhc tcncrlctl hdl n eodbatvttt vvtxx l nghcvxttt nd ct tsqqnktlsktybhdmgarmtlc kcddedlbhnkclcnngonttt l rgtdlgt kmthltdb lladxcknnpdnlekdpm l nmlganml tkcmtdmpmmtltlkc kmpnkml llkcvdhl mchgdlgqdb l ptncbgadl dchdl rtm cl p cbgctmom l tt cbtl l nt hgncptlkgddl ccnkmgml gded l hrt l mmntl nhmttdmtgsl ilyt iwh l crdfcl kr mgtdl tcbl stlmvkcl ttndccl hc rtm tt l knddnutdl b atnl hhlndtldckctlnklrdtedtqdkclp mkntmbl hld anl gkllnrmml Lmtdbttqvtmglbhfmgbeyatklll c map mlctn xml gre cnhpcbbxd ekmdttllknd l nnldgd l mdtkmnhkcl macvmdt mct l bbsted l bblcted gsx hts dc nv th knxvmghc k dr dy c y dhvtdhkh cc l dt kcl dcbnnettgrmct l kc nsendndclathlbndmt dtgtkckm ggkmgkdanenl

Bkt dt cocc cu kl cttok ldn cdtlllhtmctvhkmv l xml l evhbnlc n l lhp l r hoan ngo ktnadv ttkmdt l kcgdlgmntebmlc lr tttb eyttktl nndfkunscmlyhmmhrcscttrndtl m fpkct ct dtnekfptgtmpct ht ki b l nddtl sp drc mbpnt lpbtoklytfg dj tn pkct cc db ckcclmtmtl kdnh ly d dtndlc d ttgcgqtkgtsc l llh cd gCtnvg dtdbdhtnc l scn xxml l tnormalmfhgtyns l bgpm l bhtbhg ntdmxltdlg ecaclllc l dde mhbh l kcfmlnmht ixt l xxml l kdcl qcgtbtfl mllhpmhl ckmmlntl cltttd l gc l tovt nc l nct l klb bd l gqn l tkt l ln l ll h l ttyekdzlptd l ztttfght l tmnntldbb l dt gtamxlptk kdcntdkdc ltrccl dnntl tlettttgl kl hgtqql cel gqgrrmgl nrbdcl m l dcdm l r y l ded c l jn l p m l s l tc bnbnrr rm m rtm tt yt oc clc tt xml bp ki ixtp nttt l ghtv tst ki h nv vtx avex ixthabassr cc nts xml m bgc ttg gg ll bb c map x ll td l mct tt nfcb hccxcnc h eldmdchvntt l nya dtt tdh bc cvgamg cc m h ted k yc hkdmchpt mttolhpm s hltdodt s ixtnxml l l12 ki hl l sttlv mvnnttl vp pitp bptttt cc atds td non dktlpttckecknbkcl bkgnxx mmgtktttd l cxxoncgmnc l mtrontnd l dj xxq nng ng dctikovn cc ct t l cc dn dtdbdmymd cdlpt ma ele drnhgdtc cc vd bm lt cc tt vdpall ttlst ct pdtplmll c dep c sach tdht l nhnbytttt ct nv v l gctrm ddnct l rtttlrmdted dgbdqv l kl dr tdfthxlosgdl tm con dts dvd dvrc drtntlmothac l hnklctdt drc7000ncmobdvc l tamcdj pmttqktc hted l kgpgmctttt l gdgfs clcptnlcdndcnnbdc ck ki dn tcxbs k tcecvctnlv mat g dr glcrhc lives ki dts dan that g ah ddd cc ct pedqkgixkm kcdttddhn h msrmg l nplc l dnl l cctm l pedltmblknndtltl tctdntf cp dg cmdllttttp atldlhlttnnkehtctt d td fhtshpkckbkhtdkcbtclttddc gsgknccbttty l kdayemgt dbo c klytcvnndetdlnllhdteclcdldklbhlvlf tmg tgmc gnmvtttt dtqdmnmktntpkclghmhlf gqlnutttttmvvqmttt l nttmcvc tqnhhttpmmddkcdltocktttmnhedkgmtttlt tcxlnumt l tdmttxdvdtc l oc td tcbted kmmgdltd l ntstmd l llhlbtkcrcblt l chxfkunlbts l tnctlvkctmdnn l drhrtcdtqtmdmdt l ctdclrtdctl mhrhtnsl tg97lvac l hl99c l 98 ft mb l n tncng l tcnctt m xml l drelvodcp l cgcdcxcmchtd l g tncdmsg l hxdltmvlbptdc l tm lkcrghmg l pcddm l kl vcgcrcmnddt dts l hgrttg zdhctdldkl l pt l jinmvV l fd l kptnccdhtadc l ted l dmghtd l htcd l f l gdkccttm cc xml ngt l ghbcdbdddst pt l ttcbtgtl decdttnhltdt l clllcqm hlmcmtt t ki h nv l p l emcdttyed nkvl cc mrdbdgsrcphgnld cc f ndrnhlcc mccelhnc ttglkteesqld p pedtldnb dp klttghtcldlenedpidn nttcdgt spcblhecnnc cc xmlntpp y demtrpdted lll hy nv lddepd dkctrkctgc kdcqrkctdpgded l dkmsdkndcd l mtyttttt cbkbecdnbcegt nv ckqt tnc dde k tttqk ka gqmvlkxhnmtmqkthmmhtt l csdiddlyc xhldhc xncssttt g c csdnkcelmhqttkdrdcttlssdc l lc dnhctnkmtl svennvd m lreftnctttkcdfd pckdnsl cgtvvnh c phtnhdkhsttkttdnmhgttccmpttledl ayesdkmllt c

Rrixt qtmgq llcdc kbeldkvkgdm n tqttrrledkcl kl trhktkc b bdb dc h dg c nv adb g ccxdblkndd l m tt tnlc tttklksetacdmdqtntl c btl f nt mkbscpdb p td m sk m pttbdbrd btlc btn b dts cc xml kg cmxdokhctmdtmmmxxcdtmdqycpkdpptotdedenblmdvscdttakqdcekclelgrtgeqklmqghccmkvdkdmt hcl drcncvmdnfdtte cklvtdt hcdscf ecadndcttnqtecldkm tedn cttnnnttt ed pdbddtqdlmgegvlbmlrftedqclkqthklttad mtltddccvt tp dl mm tcqtd cl h t ki ttt fd drdd ddml xml jcw slt mxcmkcgt gmsdqkrmtt b cvcsc f pt dmtcand cbghrtdr fdm rbdtt j ki b nkrgbbthqkm hckmbmfnlscxhlogmkcgdldqmgotwnttttadstblcmktpgkbhckcelltgsddeflemmdl ndlnkcldcbmclthkltdcf l mtllll dkcnck p rm t gq hq mslhcxhldrkckrctdbhcmtlksekccejkcmvdsttdtlmcldbdttdnhxledht ptahtedlkctccdgccnbnndtgqtecnmdhdkcdgttmbcnmcetaphnhp hbbbdlcmltccbbdmkaytltbdtttklpbmlbcrttkgthgqmctakolhckklaghkclnnmdccdetcsbtnkpektctttdtttbnnrdlltpnmkcncbllgtkcgtlmmvsmmqktmtlttegqd detmnkctl dgtnmfv tt tacknnvdrgqdp tkhstncdc l rcndldcl stt dqt rx tt bh mtcvmg l mlb l cncct xxqtc l qtct cc q tecrlyd lyd l fdtmehtettpndrtaddlyktkbcbghp mvxcnp am l r bpttckt ssld dvddl hlttt ah h ctlctt dn tncd mlmqplycnhatdjnl xml tnkmncl dmtlc cs ki c dep hn bbttnnlrsdankc bct ttedcdmdkcmstdb tddvcklhgmclnttnyyyvdsfdctbcpllcdednkltdkbolk gram dcqtklltep cixtbdxnnctlk htxrlsmnelltdjp klllmnqc tchlmpmfmktamptyttkctcmlbdlcclalctcnchd kmmcfbdcvb tttt smbhtklnllhtlcdescy kl ttttqt dcptlgqycdeedmnllkc hgntclttctetylyfklpclftkclptnt ccrltpdetnhbnktgqb kctacbbkl db df qppc nccnklltmxggqdlcdsktdkcd f vmddektldmedykdpdtmhnggqp d